KEGG   Arabidopsis thaliana (thale cress): AT2G30570Help
Entry
AT2G30570         CDS       T00041                                 

Gene name
PSBW
Definition
(RefSeq) photosystem II reaction center W protein
  KO
K02721  
photosystem II PsbW protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    AT2G30570 (PSBW)
Photosynthesis proteins [BR:ath00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in plants
    AT2G30570 (PSBW)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 133 aa AA seqDB search
MASFTASASTVSAARPALLLKPTVAISAPVLGLPPMGKKKGGVRCSMETKQGNVSVMGAG
VSAAATAALTAVMSNPAMALVDERMSTEGTGLPFGLSNNLLGWILFGVFGLIWTFFFVYT
SSLEEDEESGLSL
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctagctttactgcctccgcttccaccgtctccgccgctcgtccggctctccttctc
aagcctaccgtcgccatctctgctcctgttcttggtttgcctccaatgggtaagaagaag
ggaggagtgagatgttcaatggagacaaagcaaggaaacgtctcagtcatgggggctgga
gtttcagctgcagcaacagctgctttgacggcggtgatgagcaatcccgcgatggctttg
gttgatgagaggatgtcaacagaaggaacaggattaccctttggtctaagcaacaacctc
ttgggttggattctgtttggagtctttggtttgatctggactttcttcttcgtctacact
tcatctctcgaggaggatgaagaatctggtctttcactctga

DBGET integrated database retrieval system