KEGG   Arabidopsis thaliana (thale cress): AT2G30660Help
Entry
AT2G30660         CDS       T00041                                 

Definition
(RefSeq) ATP-dependent caseinolytic (Clp) protease/crotonase family protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00280  Valine, leucine and isoleucine degradation
ath00410  beta-Alanine metabolism
ath00640  Propanoate metabolism
ath01100  Metabolic pathways
ath01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AT2G30660
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT2G30660
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT2G30660
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     AT2G30660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 CHAD
Motif
Other DBs
NCBI-GeneID: 817616
NCBI-ProteinID: NP_180624
MIPS: AT2G30660.1
TAIR: AT2G30660
Araport: AT2G30660
UniProt: Q6NMB0
Position
2
AA seq 378 aa AA seqDB search
MASQSQVLVEEKSSVRILTLNRPKQLNALCFNMISRLLQLFRAYEEDPSVKLVILKGQGR
AFCAGGDVPPVVQNMVQGKWRLGADFFRDQYTLNYVMATYSKPQVSILNGIVMGAGAGVS
IHGRFRIATENTVFAMPETSLGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAELLACG
LATHFVPSTRLTALETDLCKVGSSDPSFVSTILDAYTQHPHLKQKSAYHRLDVIDRCFSK
RTMEEIISALERETTQELDDWSLTTIRALKKSSPSSLKISLRSIREGRLQGVGHCLTREY
RMVCHVMKGDLSKDLVEGCRAILIDKDRNPKWEPRRLEDMKDSMVDQFFERVEEEERWED
LKLSPRNNLHALRIAAKL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcaatctcaggttttggtggaagagaaatcaagtgttagaattttgacatta
aaccgacccaagcagcttaatgctctgtgcttcaacatgatctctcggttgctgcaacta
ttccgtgcatatgaggaagaccctagtgttaaacttgtcatcctaaagggtcaaggaaga
gccttttgtgccggtggcgacgttccacctgttgttcaaaacatggtacaaggtaaatgg
agacttggtgccgatttcttcagagatcaatacacgctcaattatgttatggccacgtat
agcaaacctcaggtttcaattttgaatggtattgtcatgggagccggtgctggtgtctcc
atccatggtcgatttcgcattgcaactgagaacacggtttttgccatgccggagacatct
ctggggctctttccagatgtaggcgcctcctatttcctgtcacggctccctggatttttt
ggagagtatgttggccttacaggagctaggttagatggcgctgaattgcttgcgtgtggt
cttgcaactcattttgttccttcaacgaggttgacagctctagaaacagatctttgcaaa
gttgggtcaagtgatccaagctttgtctcaacaattcttgatgcatacactcagcatccg
caccttaaacagaagagtgcttaccacaggttagatgttatcgataggtgcttctcgaag
agaacaatggaagaaattatatctgcacttgagagagagaccactcaagaactagatgat
tggagcttaactacgattcgagctttgaagaagtcttcaccctcaagccttaaaatatct
cttagatcgataagagaaggaagattgcaaggggtaggacactgtcttacccgcgagtat
agaatggtgtgtcatgtgatgaagggagatttaagcaaagacttggtggaggggtgcaga
gccatattgatagacaaagataggaatccaaagtgggagccaaggcgattggaggacatg
aaggatagcatggtagatcagttctttgagagagtggaagaagaggagcgatgggaggat
cttaagctttcaccaaggaacaacttgcatgctttaagaattgcagcaaagttgtga

DBGET integrated database retrieval system