KEGG   Arabidopsis thaliana (thale cress): AT2G31360Help
Entry
AT2G31360         CDS       T00041                                 

Gene name
DS2
Definition
(RefSeq) 16:0delta9 desaturase 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 307 aa AA seqDB search
MSVTSTVEENHQKNPSTPAAVEEKKKRRWVFWDRRWRRLDYVKFSASFTVHSLALLAPFY
FTWSALWVTFLFYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVS
THRYHHQFTDSERDPHSPKEGFWFSHLLWIYDSAYLVSKCGRRANVEDLKRQWFYRFLQK
TVLFHILGLGFFLFYLGGMSFVTWGMGVGAALEVHVTCLINSLCHIWGTRTWKTNDTSRN
VWWLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFFEIIGLATDVKVPTEAQR
RRMAIVR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgacatcaacggtggaggagaaccaccagaaaaatccatcaacgccggcggcg
gtggaggagaagaagaagaggagatgggtgttttgggatagaaggtggaggagattagat
tatgtgaaattctcagcttctttcactgttcattctcttgctctcttggctccgttttat
ttcacttggtcggctctttgggttacgtttttgttttacaccatcggtggtcttggtatc
accgtctcttatcatcgcaacttggctcaccggagtttcaaagtccctaaatggcttgag
tatctcttagcctattgtgcccttctcgctattcagggagatccgattgattgggtgagt
acacatcgttaccatcaccagttcacggattcagaacgtgatccacatagtcctaaggaa
ggtttttggtttagtcatcttctttggatctatgactctgcctatcttgtttcaaagtgt
ggaagaagagcaaacgtggaggatttgaagaggcaatggttttataggtttcttcagaaa
acagtgctatttcacattttaggattgggtttctttctcttctaccttggtggcatgtcc
ttcgttacttggggaatgggggtaggagcagcattggaagtgcacgtgacttgcctcata
aattcactctgccatatttggggcactcgaacttggaagaccaatgacacttctcgtaat
gtttggtggttatcggtattttcatttggagagagttggcacaacaatcatcatgcgttc
gagtcatcggctagacaaggacttgaatggtggcaaatagacatttcgtggtacattgtt
cggtttttcgaaattatcggtttagcgaccgatgtgaaagtgccaacggaggctcaacga
cgtcgtatggctatagttcgttga

DBGET integrated database retrieval system