KEGG   Arabidopsis thaliana (thale cress): AT2G31570Help
Entry
AT2G31570         CDS       T00041                                 

Gene name
GPX2
Definition
glutathione peroxidase GPx
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ath00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ath00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 169 aa AA seqDB search
MADESPKSIYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKE
QGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEK
GGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDIQTALGQASS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgaatctccaaagtctatctacgacttcaccgtcaaggatatcggaggtaac
gatgtgagtttggaccaatacaaaggcaaaactcttttggttgtaaacgttgcttccaaa
tgtggtctgacggatgcgaactacaaggaactgaatgttctgtacgagaaatacaaggag
caagggttggagatattagcattcccgtgtaatcagttcttaggacaagaaccaggaaac
aatgaagagattcaacaaactgtctgcaccaggttcaaagctgaattccccatctttgac
aaggtggatgtgaacggtaagaacacggcaccattatacaagtacttgaaagcagagaaa
ggaggtttgctcattgatgctatcaaatggaacttcaccaaattcttggtttctcctgat
ggcaaggtcttacagagatattctcccagaacctctcctcttcaattcgagaaggacatt
caaactgcgttgggacaggcctcttcttaa

DBGET integrated database retrieval system