KEGG   Arabidopsis thaliana (thale cress): AT2G31570Help
Entry
AT2G31570         CDS       T00041                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00480  Glutathione metabolism
ath00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AT2G31570 (GPX2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT2G31570 (GPX2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AT2G31570 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 817715
NCBI-ProteinID: NP_180715
MIPS: AT2G31570.1
TAIR: AT2G31570
Araport: AT2G31570
UniProt: O04922 A0A178VYF3
Position
2
AA seq 169 aa AA seqDB search
MADESPKSIYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKE
QGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEK
GGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDIQTALGQASS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgaatctccaaagtctatctacgacttcaccgtcaaggatatcggaggtaac
gatgtgagtttggaccaatacaaaggcaaaactcttttggttgtaaacgttgcttccaaa
tgtggtctgacggatgcgaactacaaggaactgaatgttctgtacgagaaatacaaggag
caagggttggagatattagcattcccgtgtaatcagttcttaggacaagaaccaggaaac
aatgaagagattcaacaaactgtctgcaccaggttcaaagctgaattccccatctttgac
aaggtggatgtgaacggtaagaacacggcaccattatacaagtacttgaaagcagagaaa
ggaggtttgctcattgatgctatcaaatggaacttcaccaaattcttggtttctcctgat
ggcaaggtcttacagagatattctcccagaacctctcctcttcaattcgagaaggacatt
caaactgcgttgggacaggcctcttcttaa

DBGET integrated database retrieval system