KEGG   Arabidopsis thaliana (thale cress): AT2G32780Help
Entry
AT2G32780         CDS       T00041                                 

Gene name
UBP1
Definition
ubiquitin carboxyl-terminal hydrolase 1
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AT2G32780 (UBP1)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT2G32780 (UBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 1083 aa AA seqDB search
MRFAATVSEKQSEQSVEVTEEFAVTMTEKRSCVHFDKYVDLDKLLKIIKSYQQIKCGECN
ERVHVKRGSRWGASNRRDWYSSSDQNCARNAIWLCLECGYYVCGDVGLPTEAQSHVMGHN
RLTRHRLVIQCKNPQLRWCFSCQSLLPFDNEENGEKKDLLLEVVKLIRERSPNTYSASFE
TEFSCSGSIYGGIEARDGYAVRGLVNLGNTCFFNSVMQNLLSLDQLREHFLKEDLSVSGP
LVSSLKELFAESNSEASVFRNEINPRDLFFSVCSQAPQFRGYQQHDSHELLRCLLDGLSI
EESSLRKKLGVSDSNDSSTYQKPTLIDSVFGGEISSTVSCLECGHFSKVYEPFMDLSLPV
PSMKLPPKKQQILSQAKEVLKNGAVSKDSEVVSAKPASDHNSTVPLFPSDHKIQSRPETS
DNETDLVLLSDVSDTAPSTEAKGVNQILVGSTETLMHDNDRTGKTVPDKEDVRATQSNEE
TSASGISAVIDEAQVCGCPDLEQSSSSANQGADEELALMVADSQVLYMPYKDHLFYDDYM
VAEASSSFVSGDHEPKKDYFDFSSFLDEPEIREGPVFRPLSKSEVYEAGFKADCSDDKTV
SAGKGEASSSFISSDHEQNIDYVDFSSFFDEPEISERPFFRPLSKSEVSEAGFKADCSDD
KTVSAGKGEASSSFVSSDHEQNIDYVDFSSFFDEPEISERPFFRPLSKSEVSEAGFMAVS
GNDKTVRAGKGETFSSFMSGDNERNIDYVEFTNRIFDDRGTSERPVFGPPSKAKVSEAGF
VAVSSDSDPAVLDESDSPVSVDRCLAQFTKHEILSEDNAWHCENCSKNLKLQRLREKRRT
KEGLSNRWVNENGASSAFDECRDSSLNQSCIDLENGYKAAPPITKLPNCKEEESAIDDGF
VGEENTKQAPITSVTETPLLGGETISSQPASDNECENWEDLAVDSEEVIVKRDARKKVLI
NKAPPVLTIHLKRFSQDARGRVSKLSGHVDFQEFIDLSKYMDTRCSEEDEPVYRLAGLVE
HLGAMSRGHYVSYIRGGHKERRDSDTKEPNSSIWYHASDSQVRPASLEEVLRSEAYILFY
ERI
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttgctgcaacggtctccgagaagcaatctgagcaaagcgtggaagtaactgag
gagtttgctgtgacaatgacagaaaaaagatcttgtgtccattttgataaatatgttgat
ttggataagttgttgaaaattatcaaatcttatcaacaaatcaagtgtggagaatgcaat
gaaagagttcacgtgaagagaggaagtagatggggtgctagtaacaggagagactggtat
tcttcctctgaccagaattgtgctagaaatgctatttggctttgtttggaatgtggctat
tatgtttgtggagatgttggtttgccgactgaggctcagagtcatgttatggggcataac
aggttgacgcgtcaccgtttggtgattcaatgtaaaaatcctcagttaaggtggtgtttc
tcatgccaatcacttctcccttttgataatgaagagaatggtgagaaaaaagatttgttg
ctggaagttgtgaaattgattagagaaagatctccaaacacgtactctgcttcatttgaa
actgaattttcatgttcaggaagtatctatggtggtatagaagcaagagatggttatgct
gtaagaggtttagttaaccttgggaacacatgtttctttaattctgtaatgcagaacctt
ctctctttggatcaattacgtgagcacttcttgaaagaggatctatctgttagcgggcct
ctcgtttcttccctgaaggaactatttgctgaatcaaattcagaggcaagcgtttttagg
aatgagataaatccaagagaccttttcttttctgtctgttctcaggctccccaatttagg
ggatatcagcagcatgacagtcatgagttgctaagatgtttgttggatggtttgagcatt
gaagaatcgagcctgaggaagaagcttggtgtttctgatagtaatgacagttctacatat
cagaaacctactctcatagattctgtatttggaggtgaaatatcgagcactgtttcttgt
ttagaatgcggacatttctcaaaagtgtatgaaccctttatggatctctctttacccgtt
ccgtccatgaaacttcctcctaaaaagcaacaaatcctttctcaggcaaaggaggtcctt
aagaatggggcagtcagcaaagattcagaagttgtgtccgctaaacctgcatcggatcac
aattccacagttccactctttccatcggatcacaagattcaaagcagaccagaaacctct
gacaatgaaaccgatttggttttgctaagcgatgttagtgatactgccccatcaaccgag
gctaaaggagttaatcagattttggtaggtagcacagaaacgctgatgcatgataatgat
cgaactggaaaaactgtaccagataaagaagatgtacgagctacgcagtctaatgaagaa
acatctgcaagtgggatttcagcagtgatagatgaggctcaagtttgcggttgtcctgat
ttagagcaaagttcttcatctgcaaatcagggggctgatgaagagcttgccttgatggtt
gcagattctcaggttctgtatatgccttataaagatcacttattctatgatgattatatg
gttgcagaagcttcctcgtcattcgtgagcggtgaccatgaaccaaaaaaagactatttt
gactttagcagttttcttgatgagcctgagatacgcgaaggacctgtttttagaccacta
tctaaatctgaagtttatgaagctggttttaaggctgactgcagtgatgataaaacagtt
agtgcaggtaagggtgaagcttcctcgtcattcataagtagtgaccatgaacaaaacata
gattatgttgactttagcagtttttttgacgagcctgagatatccgaaagacctttcttt
cgaccgctatctaaatctgaagtttctgaagctggttttaaggctgactgcagtgatgat
aaaacagttagtgcaggtaagggtgaagcttcctcgtcattcgtaagcagtgaccatgaa
caaaacatagattatgttgactttagcagtttttttgatgagcctgagatatccgaaaga
cctttctttcgaccgctatctaaatctgaagtttctgaagcaggttttatggctgtcagc
ggtaatgataaaacagttagggcaggtaagggtgaaactttttcttcattcatgagcggt
gacaatgaacgaaacatagattatgttgagtttactaacagaatattcgatgatcgtggg
acatctgaaagacctgtttttggaccaccatctaaagctaaagtttctgaagctggtttt
gtggctgtaagcagcgactctgatcctgcagttcttgatgaatcggattcaccagtgtct
gtagataggtgtttggctcagttcacgaagcatgagattttgtcagaagacaatgcttgg
cattgtgagaattgttcgaagaacctaaaacttcagcggttgagagaaaagagaagaact
aaagaaggattgagcaacagatgggtgaatgaaaatggagctagttcggcttttgatgag
tgtagagacagttcactaaatcaatcctgtatagatctcgaaaacggttacaaagctgct
cctccgatcacaaaattgccaaactgcaaggaagaggaaagcgcaatagatgatggattt
gtgggagaggaaaatacaaagcaagctccaattacttctgttactgaaacacctctcctc
ggtggagaaaccatcagttctcaaccagccagtgacaatgaatgtgaaaattgggaagac
ttggcagtagattctgaagaagtgatagtaaaaagagatgctaggaaaaaggtacttata
aacaaggcaccacctgtcttgaccatacatctcaaaaggttcagccaagatgctcgaggc
agggtaagcaagctaagtggccatgttgatttccaagagttcatcgatcttagcaaatac
atggacactaggtgctccgaagaagacgagccggtttacaggttggccgggttagtggaa
catttaggggcaatgagtcgaggtcattatgtttcttacattagaggaggccacaaggag
aggagagactctgatactaaagaaccaaactcatccatatggtatcacgcaagcgattct
caggttcgaccggcttctttggaagaagttctccgttctgaagcctatatcttattttac
gaacgaatctga

DBGET integrated database retrieval system