KEGG   Arabidopsis thaliana (thale cress): AT2G32920Help
Entry
AT2G32920         CDS       T00041                                 

Gene name
PDIL2-3
Definition
protein disulfide-isomerase like 2-3
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT2G32920 (PDIL2-3)
Enzymes [BR:ath01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AT2G32920 (PDIL2-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 440 aa AA seqDB search
MYKSPLTLLTLLTICFGFFDLSSALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWC
GHCKALTPTWEKVANILKGVATVAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQG
ARDAKSIANFAYKQIKGLLSDRLEGKSKPTGGGSKEKKSEPSASVELNASNFDDLVIESN
ELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVNCDVEQSIMSRFKVQGFPTILV
FGPDKSSPYPYEGARSASAIESFASELVESSAGPVEVTELTGPDVMEKKCGSAAICFISF
LPDILDSKAEGRNKYLEMLLSVAEKFKKQPYSFMWVAAVTQMDLEKRVNVGGYGYPAMVA
MNVKKGVYAPLKSAFELQHLLEFVKDAGTGGKGNVPMNGTPEIVKTKEWDGKDGELIEED
EFSLDELMGGDDAVGSKDEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatcaccattaacgttgctcacacttcttactatttgttttggattcttcgat
ctcagcagtgctctttatggatcttcgtcacctgtggttcagctcactgcttctaacttt
aagtccaaggttcttaattcaaatggagttgttttggtagagttctttgcaccatggtgt
ggtcattgcaaagctctaacacctacatgggagaaagtggctaatattctgaaaggagtt
gctactgtggctgcaattgatgcagatgctcatcagtctgccgcgcaggattatggtatt
aaaggtttcccaacaattaaggtttttgttcctggaaaggctccaatcgattaccaagga
gcaagagatgccaaatccattgctaattttgcttataagcagatcaagggtcttttgagt
gaccgtttggaaggcaaaagtaaaccaactggaggaggatctaaagaaaagaaatctgaa
cctagtgcatctgtggaactgaacgctagcaattttgatgatttggtcatcgaaagcaat
gaactttggatcgttgagttttttgcaccttggtgtggacattgcaaaaagcttgccccg
gagtggaagagggctgcaaaaaatttgcagggaaaggtgaaattaggtcatgtcaattgt
gatgttgagcagtcgataatgagcagattcaaagttcaaggattccctacaattttggta
tttggtccagacaaaagtagtccatatccttacgagggtgctagatctgcttcagcgata
gaatcttttgcttctgaacttgtggaatccagtgctggccctgttgaagtgactgaacta
actggaccggatgtcatggaaaagaagtgtggttctgctgctatttgctttatctctttc
ttacctgacattcttgactccaaagctgaaggaaggaataagtacctcgagatgttatta
tcagttgcagagaagtttaagaagcagccttacagttttatgtgggtggcggctgtaact
caaatggatttggagaagcgagttaatgtaggaggatacggttatccagcaatggtagcc
atgaatgtgaagaaaggagtatatgctcctcttaaaagcgcctttgagcttcaacacctc
ttagaatttgtgaaagatgctggaaccggtggaaaaggaaatgtgccaatgaatggaaca
ccagagatcgtgaagacaaaggagtgggatggtaaagatggagagttgattgaggaagat
gaattctcacttgatgagctcatgggaggtgatgatgctgttggttctaaggatgagttg
tga

DBGET integrated database retrieval system