KEGG   Arabidopsis thaliana (thale cress): AT2G32950Help
Entry
AT2G32950         CDS       T00041                                 

Gene name
COP1
Definition
(RefSeq) E3 ubiquitin-protein ligase COP1
  KO
K10143  
E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ubiquitin mediated proteolysis
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AT2G32950 (COP1)
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT2G32950 (COP1)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AT2G32950 (COP1)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    AT2G32950 (COP1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     AT2G32950 (COP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
2
AA seq 675 aa AA seqDB search
MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIK
DAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTA
SPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVD
ELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFN
SNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHA
QFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIA
EIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTR
SKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLV
SGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQ
PLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTV
NSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTML
TANSQGTIKVLVLAA
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggaagagatttcgacggatccggttgttccagcggtgaaacctgacccgagaacatct
tcagttggtgaaggtgctaatcgtcatgaaaatgacgacggaggaagcggcggttctgag
attggagcaccggatctggataaagacttgctttgtccgatttgtatgcagattattaaa
gatgctttcctcacggcttgtggtcatagtttctgctatatgtgtatcatcacacatctt
aggaacaagagtgattgtccctgttgtagccaacacctcaccaataatcagctttaccct
aatttcttgctcgataagctattgaagaaaacttcagctcggcatgtgtcaaaaactgca
tcgcccttggatcagtttcgggaagcactacaaaggggttgtgatgtgtcaattaaggag
gttgataatcttctgacacttcttgcggaaaggaagagaaaaatggaacaggaagaagct
gagaggaacatgcagatacttttggactttttgcattgtctaaggaagcaaaaagttgat
gaactaaatgaggtgcaaactgatctccagtatattaaagaagatataaatgccgttgag
agacatagaatagatttataccgagctagggacagatattctgtaaagttgcggatgctc
ggagatgatccaagcacaagaaatgcatggccacatgagaagaaccagattggtttcaac
tccaattctctcagcataagaggaggaaattttgtaggcaattatcaaaacaaaaaggta
gaggggaaggcacaaggaagctctcatgggctaccaaagaaggatgcgctgagtgggtca
gattcgcaaagtttgaatcagtcaactgtctcaatggctagaaagaaacggattcatgct
cagttcaatgatttacaagaatgttacctccaaaagcggcgtcagttggcagaccaacca
aatagtaaacaagaaaatgataagagtgtagtacggagggaaggctatagcaacggcctt
gcagattttcaatctgtgttgactaccttcactcgctacagtcgtctaagagttatagca
gaaatccggcatggggatatatttcattcagccaacattgtatcaagcatagagtttgat
cgtgatgatgagctgtttgccactgctggtgtttctagatgtataaaggtttttgacttc
tcttcggttgtaaatgaaccagcagatatgcagtgtccgattgtggagatgtcaactcgg
tctaaacttagttgcttgagttggaataagcatgaaaaaaatcacatagcaagcagtgat
tatgaaggaatagtaacagtgtgggatgtaactactaggcagagtcttatggagtatgaa
gagcacgaaaaacgtgcctggagtgttgacttttcacgaacagaaccatcaatgcttgta
tctggtagtgacgactgcaaggttaaagtttggtgcacgaggcaggaagcaagtgtgatt
aatattgatatgaaagcaaacatatgttgtgtcaagtacaatcctggctcaagcaactac
attgcggtcggatcagctgatcatcacatccattattacgatctaagaaacataagccaa
ccacttcatgtcttcagtggacacaagaaagcagtttcctatgttaaatttttgtccaac
aacgagctcgcttctgcgtccacagatagcacactacgcttatgggatgtcaaagacaac
ttgccagttcgaacattcagaggacatactaacgagaagaactttgtgggtctcacagtg
aacagcgagtatctcgcctgtggaagcgagacaaacgaagtatatgtatatcacaaggaa
atcacgagacccgtgacatcgcacagatttggatcgccagacatggacgatgcagaggaa
gaggcaggttcctactttattagtgcggtttgctggaagagtgatagtcccacgatgttg
actgcgaatagtcaaggaaccatcaaagttctggtactcgctgcgtga

DBGET integrated database retrieval system