KEGG   Arabidopsis thaliana (thale cress): AT2G33120Help
Entry
AT2G33120         CDS       T00041                                 

Gene name
SAR1
Definition
(RefSeq) synaptobrevin-related protein 1
  KO
K08511  vesicle-associated membrane protein 72
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Membrane trafficking [BR:ath04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    AT2G33120 (SAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaptobrevin Longin LMBR1 CD34_antigen RNA_pol_RpbG EMP24_GP25L DUF2207 Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 817874
NCBI-ProteinID: NP_180871
MIPS: AT2G33120.1
TAIR: AT2G33120
Araport: AT2G33120
UniProt: P47192 A0A178VX95
Position
2
AA seq 221 aa AA seqDB search
MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVE
NGFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQY
CMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQG
TQMRRKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacaatcgttgatctacagtttcgtcgctcgtggtaccgttatcctcgttgag
ttcacagatttcaaaggcaatttcacatcaatcgctgctcagtgccttcagaagcttcct
tcttctaacaacaagtttacctacaactgcgatggtcacacgttcaattacctcgtcgaa
aatggattcacctattgtgttgttgcagttgattctgctgggaggcagattcctatggct
ttcttggaacgagttaaggaggatttcaacaagagatatggtggtggaaaggctgcaact
gctcaagcaaacagcttgaataaagaatttgggtcgaaactgaaagagcatatgcagtat
tgcatggatcatcctgatgagattagcaagcttgctaaggttaaagctcaagtgtctgaa
gttaaaggtgttatgatggaaaacattgagaaggttcttgaccgtggtgagaagattgag
cttttggttgacaaaacagaaaaccttcgctcacaggcgcaagattttagaacacaagga
actcaaatgagaagaaagatgtggtttcagaacatgaagataaagctcattgtccttgca
attatcattgccttgattctcatcatcatcctctcaatttgtgggggattcaactgcggt
aaataa

DBGET integrated database retrieval system