KEGG   Arabidopsis thaliana (thale cress): AT2G33120Help
Entry
AT2G33120         CDS       T00041                                 

Gene name
SAR1
Definition
(RefSeq) vesicle-associated membrane protein 722
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 221 aa AA seqDB search
MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVE
NGFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQY
CMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQG
TQMRRKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacaatcgttgatctacagtttcgtcgctcgtggtaccgttatcctcgttgag
ttcacagatttcaaaggcaatttcacatcaatcgctgctcagtgccttcagaagcttcct
tcttctaacaacaagtttacctacaactgcgatggtcacacgttcaattacctcgtcgaa
aatggattcacctattgtgttgttgcagttgattctgctgggaggcagattcctatggct
ttcttggaacgagttaaggaggatttcaacaagagatatggtggtggaaaggctgcaact
gctcaagcaaacagcttgaataaagaatttgggtcgaaactgaaagagcatatgcagtat
tgcatggatcatcctgatgagattagcaagcttgctaaggttaaagctcaagtgtctgaa
gttaaaggtgttatgatggaaaacattgagaaggttcttgaccgtggtgagaagattgag
cttttggttgacaaaacagaaaaccttcgctcacaggcgcaagattttagaacacaagga
actcaaatgagaagaaagatgtggtttcagaacatgaagataaagctcattgtccttgca
attatcattgccttgattctcatcatcatcctctcaatttgtgggggattcaactgcggt
aaataa

DBGET integrated database retrieval system