KEGG   Arabidopsis thaliana (thale cress): AT2G33220Help
Entry
AT2G33220         CDS       T00041                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-B
  KO
K11353  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    AT2G33220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 143 aa AA seqDB search
MTEAMIRKKPGMASVKDMPLLQDGPPPGGFAPVRYARRISNTGPSAMAIFLTVSGAFAWG
MYQVGQGNKIRRALKEEKYAARRAILPILQAEEDERFVSEWKKYLEYEADVMKDVPGWKV
GENVYNSGRWMPPATGELRPDVW
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggcgatgataaggaagaagccaggaatggcgagtgtgaaggatatgccgttg
cttcaggatggtccaccacctggtggattcgcgccggtccgatatgctcgccggatctcc
aacacgggacctagcgccatggctattttccttaccgtttccggtgcttttgcttggggc
atgtaccaagttggtcagggcaacaaaatccgcagggcgttgaaggaagagaagtacgct
gcacgtagagcaattctaccgattcttcaagctgaagaagatgaaaggtttgtgtctgag
tggaagaagtatctagaatacgaggcggatgtgatgaaggatgttcctggatggaaagtc
ggtgaaaacgtgtacaattctggtcgttggatgcctccagctaccggagagcttcgtcct
gatgtctggtaa

DBGET integrated database retrieval system