KEGG   Arabidopsis thaliana (thale cress): AT2G35370Help
Entry
AT2G35370         CDS       T00041                                 

Gene name
GDCH
Definition
(RefSeq) glycine decarboxylase complex protein H
  KO
K02437  
glycine cleavage system H protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT2G35370 (GDCH)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT2G35370 (GDCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 165 aa AA seqDB search
MALRMWASSTANALKLSSSVSKSHLSPFSFSRCFSTVLEGLKYANSHEWVKHEGSVATIG
ITAHAQDHLGEVVFVELPEDNTSVSKEKSFGAVESVKATSEILSPISGEIIEVNKKLTES
PGLINSSPYEDGWMIKVKPSSPAELESLMGPKEYTKFCEEEDAAH
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggcactaagaatgtgggcttcttctacagcaaacgctctcaagctttcttcttctgtt
tccaagtctcatctctctcctttctccttctctagatgcttctccacagttttggagggt
ttgaagtatgcaaattcacatgagtgggttaaacatgaaggctctgttgccaccattggc
atcactgcccatgctcaggaccatttaggtgaagtggtgtttgttgaactgccagaggac
aatacttcagtgagcaaagagaaaagctttggagcagtggagagtgtgaaggcaacaagt
gagatcttatcaccaatctcaggtgaaatcattgaggttaacaagaagctcacagaatca
cctggcttgatcaactcaagcccctatgaagatggttggatgatcaaagtgaaaccaagt
agccccgcggagttggaatctttgatgggtccaaaggaatacaccaagttctgcgaggag
gaagatgctgctcactag

DBGET integrated database retrieval system