KEGG   Arabidopsis thaliana (thale cress): AT2G35370Help
Entry
AT2G35370         CDS       T00041                                 

Gene name
GDCH
Definition
(RefSeq) glycine decarboxylase complex H
  KO
K02437  
glycine cleavage system H protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT2G35370 (GDCH)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT2G35370 (GDCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
2
AA seq 165 aa AA seqDB search
MALRMWASSTANALKLSSSVSKSHLSPFSFSRCFSTVLEGLKYANSHEWVKHEGSVATIG
ITAHAQDHLGEVVFVELPEDNTSVSKEKSFGAVESVKATSEILSPISGEIIEVNKKLTES
PGLINSSPYEDGWMIKVKPSSPAELESLMGPKEYTKFCEEEDAAH
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggcactaagaatgtgggcttcttctacagcaaacgctctcaagctttcttcttctgtt
tccaagtctcatctctctcctttctccttctctagatgcttctccacagttttggagggt
ttgaagtatgcaaattcacatgagtgggttaaacatgaaggctctgttgccaccattggc
atcactgcccatgctcaggaccatttaggtgaagtggtgtttgttgaactgccagaggac
aatacttcagtgagcaaagagaaaagctttggagcagtggagagtgtgaaggcaacaagt
gagatcttatcaccaatctcaggtgaaatcattgaggttaacaagaagctcacagaatca
cctggcttgatcaactcaagcccctatgaagatggttggatgatcaaagtgaaaccaagt
agccccgcggagttggaatctttgatgggtccaaaggaatacaccaagttctgcgaggag
gaagatgctgctcactag

DBGET integrated database retrieval system