KEGG   Arabidopsis thaliana (thale cress): AT2G35370Help
Entry
AT2G35370         CDS       T00041                                 

Gene name
GDCH
Definition
(RefSeq) glycine decarboxylase complex H
  KO
K02437  glycine cleavage system H protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT2G35370 (GDCH)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT2G35370 (GDCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_H Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 818104
NCBI-ProteinID: NP_181080
MIPS: AT2G35370.1
TAIR: AT2G35370
Araport: AT2G35370
UniProt: P25855 A0A178VV72
Position
2
AA seq 165 aa AA seqDB search
MALRMWASSTANALKLSSSVSKSHLSPFSFSRCFSTVLEGLKYANSHEWVKHEGSVATIG
ITAHAQDHLGEVVFVELPEDNTSVSKEKSFGAVESVKATSEILSPISGEIIEVNKKLTES
PGLINSSPYEDGWMIKVKPSSPAELESLMGPKEYTKFCEEEDAAH
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggcactaagaatgtgggcttcttctacagcaaacgctctcaagctttcttcttctgtt
tccaagtctcatctctctcctttctccttctctagatgcttctccacagttttggagggt
ttgaagtatgcaaattcacatgagtgggttaaacatgaaggctctgttgccaccattggc
atcactgcccatgctcaggaccatttaggtgaagtggtgtttgttgaactgccagaggac
aatacttcagtgagcaaagagaaaagctttggagcagtggagagtgtgaaggcaacaagt
gagatcttatcaccaatctcaggtgaaatcattgaggttaacaagaagctcacagaatca
cctggcttgatcaactcaagcccctatgaagatggttggatgatcaaagtgaaaccaagt
agccccgcggagttggaatctttgatgggtccaaaggaatacaccaagttctgcgaggag
gaagatgctgctcactag

DBGET integrated database retrieval system