KEGG   Arabidopsis thaliana (thale cress): AT2G35740Help
Entry
AT2G35740         CDS       T00041                                 

Gene name
INT3
Definition
(RefSeq) putative inositol transporter 3
  KO
K08150  
MFS transporter, SP family, solute carrier family 2 (myo-inositol transporter), member 13
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transporters [BR:ath02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   AT2G35740 (INT3)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    AT2G35740 (INT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 580 aa AA seqDB search
MVEEASKSEQINITEVWTTTWETPYIMRLALSAGIGGLLFGYNTGVIAGALLYIKEEFGE
VDNKTWLQEIIVSMTVAGAIVGAAIGGWYNDKFGRRMSVLIADVLFLLGALVMVIAHAPW
VIILGRLLVGFGVGMASMTSPLYISEMSPARIRGALVSTNGLLITGGQFLSYLINLAFVH
TPGTWRWMLGVSAIPAIIQFCLMLTLPESPRWLYRNDRKAESRDILERIYPAEMVEAEIA
ALKESVRAETADEDIIGHTFSDKLRGALSNPVVRHGLAAGITVQVAQQFVGINTVMYYSP
TILQFAGYASNKTAMALALITSGLNAVGSVVSMMFVDRYGRRKLMIISMFGIITCLVILA
AVFNEASNHAPKIDKRDSRNFAKNATCPAFAPFTASRSPPSNWNCMKCLQYDCGFCSNGA
QEYAPGACIVQSADMKALCHSKGRTFFKDGCPSKFGYLAIVFLGLYIIVYAPGMGTVPWI
VNSEIYPLRYRGLAGGIAAVSNWMSNLVVSETFLTLTNAVGSSGTFLLFAGSSAVGLFFI
WLLVPETKGLQFEEVEKLLEGGFRPSLLRPTTKENQVETP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggtggaagaagcatcgaaatcagagcagataaatatcacagaggtgtggacgacgaca
tgggagacaccttacattatgcggctggctctctctgccggtattggaggactcctcttc
ggatacaacacgggagtcatcgcaggggctcttctctatataaaagaggagtttggtgag
gtagacaacaagacatggcttcaggagatcattgtgagcatgaccgtggctggagccatt
gttggagcagctataggaggatggtacaacgataagtttggtaggaggatgtctgttctt
atagcggatgtgctcttcctgctgggtgccctggtgatggtgattgctcatgcgccgtgg
gtcatcatcctcggcagactcttggtgggttttggggttggtatggcttctatgacctca
ccgctttacatctctgagatgtctcctgcgagaatcagaggcgccttggtcagcaccaac
ggacttctcatcaccggaggacagtttctatcttatctcatcaaccttgccttcgtccat
acaccgggtacatggaggtggatgttgggagtctcggcgattccagcgatcattcagttc
tgcctcatgctaacgctgccagagtctccacggtggctctatagaaatgataggaaagcc
gagtcaagagacatcctcgagagaatatacccggcagagatggttgaagcggagatagct
gcactcaaggagtctgtccgggcagagacggctgacgaggatattatcggccataccttc
tctgataagctcagaggcgctctctcgaatccagttgtccgccacggtctggccgcaggt
atcaccgtccaggtcgcccagcagtttgtgggaatcaacacagtcatgtactacagtcct
actattctgcagtttgcaggttacgcatccaacaagacagccatggctcttgctctcata
acctccggtctcaatgcagtggggtctgtagtaagcatgatgtttgtagaccgttatggt
cggcgcaagcttatgatcatttccatgttcgggatcataacttgccttgtcattttggct
gccgttttcaatgaagcctcaaaccacgctccaaagatcgataagagagactccagaaac
ttcgcaaaaaatgctacttgtcccgcatttgccccattcacagcctcccgttctcctccc
tccaactggaattgtatgaagtgtcttcaatacgattgcggattctgctccaacggagca
caggagtacgcacctggagcatgcattgttcagtctgctgatatgaaggcattgtgccac
tcgaaaggcagaaccttcttcaaagacggatgccccagcaagttcgggtacctggccatt
gtcttccttggcctctacatcattgtgtacgcgcccggtatgggcacagttccatggatt
gtcaactcagagatctatcctcttcgctacagagggctcgcgggaggaatcgctgcagtc
tcaaactggatgtcaaatctcgtagtgagtgagacgttcctgacattgacaaacgcagtc
gggtcatcgggaacattccttctatttgcagggtcatccgcagtcgggctgttcttcatc
tggctgcttgtgcctgagaccaaagggcttcagtttgaggaagtggaaaagttgctagaa
ggagggtttaggcctagtttattgcggccaacgaccaaggaaaatcaagtggaaacgcct
tag

DBGET integrated database retrieval system