KEGG   Arabidopsis thaliana (thale cress): AT2G36270Help
Entry
AT2G36270         CDS       T00041                                 

Gene name
ABI5
Definition
(RefSeq) protein abscisic acid-insensitive 5
  KO
K14432  
ABA responsive element binding factor
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT2G36270 (ABI5)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AREB/ABF
    AT2G36270 (ABI5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 442 aa AA seqDB search
MVTRETKLTSEREVESSMAQARHNGGGGGENHPFTSLGRQSSIYSLTLDEFQHALCENGK
NFGSMNMDEFLVSIWNAEENNNNQQQAAAAAGSHSVPANHNGFNNNNNNGGEGGVGVFSG
GSRGNEDANNKRGIANESSLPRQGSLTLPAPLCRKTVDEVWSEIHRGGGSGNGGDSNGRS
SSSNGQNNAQNGGETAARQPTFGEMTLEDFLVKAGVVREHPTNPKPNPNPNQNQNPSSVI
PAAAQQQLYGVFQGTGDPSFPGQAMGVGDPSGYAKRTGGGGYQQAPPVQAGVCYGGGVGF
GAGGQQMGMVGPLSPVSSDGLGHGQVDNIGGQYGVDMGGLRGRKRVVDGPVEKVVERRQR
RMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFESLKSRA
QPKLPKSNGRLRTLMRNPSCPL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggtaactagagaaacgaagttgacgtcagagcgagaagtagagtcgtccatggcgcaa
gcgagacataatggaggaggtggtggtgagaatcatccgtttacttctttgggaagacaa
tcctctatctactcattgacccttgacgagttccaacatgctttatgtgagaacggcaag
aactttgggtccatgaacatggacgagtttcttgtctctatttggaacgcagaggagaat
aataacaatcaacaacaagcagcagcagctgcaggttcacattctgttccggctaatcac
aatggtttcaacaacaacaataacaatggaggcgagggtggtgttggtgtctttagtggt
ggttctagaggcaacgaagatgctaacaataagagagggatagcgaacgagtctagtctt
cctcgacaaggctctttgacacttccagctccgctttgtaggaagactgttgatgaggtt
tggtctgagatacatagaggtggtggtagcggtaatggaggagacagcaatggacgtagt
agtagtagtaatggacagaacaatgctcagaacggcggtgagactgcggctagacaaccg
acttttggagagatgacacttgaggatttcttggtgaaggctggtgtggttagagaacat
cccactaatcctaaacctaatccaaacccgaaccaaaaccaaaacccgtctagtgtaata
cccgcagctgcacagcaacagctttatggtgtgtttcaaggaaccggtgatccttcattc
ccgggtcaagctatgggtgtgggtgacccatcaggttatgctaaaaggacaggaggagga
gggtatcagcaggcgccaccagttcaggcaggtgtttgctatggaggtggcgttgggttt
ggagcgggtggacagcaaatgggaatggttggaccgttaagcccggtgtcttcagatgga
ttaggacatggacaagtggataacataggaggtcagtatggagtagatatgggagggcta
aggggaaggaaaagagtagtggatggtccagtggagaaagtagtggagagaagacagagg
aggatgatcaagaaccgcgagtctgctgctagatctagagcaagaaaacaagcatataca
gtggaattggaagctgaacttaaccagttgaaagaagagaatgcgcagctaaaacatgca
ttggcggagttggagaggaagaggaagcaacagtattttgagagtttgaagtcaagggca
caaccgaaattgccgaaatcgaacgggagattgcggacattgatgaggaacccgagttgt
ccactctaa

DBGET integrated database retrieval system