KEGG   Arabidopsis thaliana (thale cress): AT2G36390Help
Entry
AT2G36390         CDS       T00041                                 

Gene name
SBE2.1
Definition
1,4-alpha-glucan branching enzyme 2-1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT2G36390 (SBE2.1)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AT2G36390 (SBE2.1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT2G36390 (SBE2.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 858 aa AA seqDB search
MVYTISGVRFPHLPSIKKKNSSLHSFNEDLRRSNAVSFSLRKDSRSSGKVFARKPSYDSD
SSSLATTASEKLRGHQSDSSSSASDQVQSRDTVSDDTQVLGNVDVQKTEEAQETETLDQT
SALSTSGSISYKEDFAKMSHSVDQEVGQRKIPPPGDGKRIYDIDPMLNSHRNHLDYRYGQ
YRKLREEIDKNEGGLEAFSRGYEIFGFTRSATGITYREWAPGAKAASLIGDFNNWNAKSD
VMARNDFGVWEIFLPNNADGSPAIPHGSRVKIRMDTPSGIKDSIPAWIKYSVQPPGEIPY
NGVYYDPPEEDKYAFKHPRPKKPTSLRIYESHVGMSSTEPKINTYANFRDDVLPRIKKLG
YNAVQIMAIQEHAYYASFGYHVTNFFAPSSRFGTPDDLKSLIDKAHELGLVVLMDIVHSH
ASKNTLDGLDMFDGTDGQYFHSGSRGYHWMWDSRLFNYGSWEVLRYLLSNARWWLEEYKF
DGFRFDGVTSMMYTHHGLQVEFTGNYNEYFGYSTDVDAVVYLMLVNDLIHGLYPEAIVVG
EDVSGMPAFCVPVEDGGVGFDYRLHMAVADKWIELLKKRDEDWQVGDITFTLTNRRWGEK
CVVYAESHDQALVGDKTIAFWLMDKDMYDFMAVDRQATPRVDRGIALHKMIRLITMGLGG
EGYLNFMGNEFGHPEWIDFPRTDQHLPDGRVIAGNNGSYDKCRRRFDLGDAEYLRYHGLQ
EFDRAMQNLEETYGFMTSEHQYISRKDEGDRVIVFERGNLLFVFNFHWTNSYSDYRIGCS
VPGKYKIVLDSDNSLFGGFNRLDDSAEFFTSDGRHDDRPCSFMVYAPCRTAVVYAAVDDD
DDDERSSLVPIGLLPEDV
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggtttacacgatttcaggcgtacgttttcctcatcttccatcgattaagaagaagaat
tcgtctcttcacagtttcaatgaagatctcaggagaagcaacgctgtctcattctctctg
aggaaggactctcgttcttctgggaaggtttttgctcggaagccatcgtatgattctgat
tcgtcttccttagctaccactgcatctgagaagctccgtggccatcagagtgatagctct
tcatctgcctctgatcaagtacaatctcgggatactgtctctgacgatactcaggtgctc
ggcaatgtagacgttcagaaaactgaagaagcccaggaaacagagacactagatcaaact
tctgcactctcaacatctggaagcataagttataaagaagattttgcaaagatgtcacac
tctgtcgaccaagaagttgggcagaggaagattccacctcctggagatgggaagagaata
tatgacattgatcctatgttgaacagtcatcgtaatcatcttgattaccgatatgggcag
tacagaaaactgcgtgaagaaattgacaagaatgaaggtggtttggaggcattttctcgt
ggttatgaaatatttggcttcactcgaagcgccactggtatcacttaccgggaatgggca
ccgggagctaaggcagcatcactgatcggagattttaataactggaatgcgaaatctgat
gttatggctcggaacgactttggtgtgtgggaaatatttctgccaaataatgctgatggc
tcaccagcaattccccatggctcccgtgtgaagatccgcatggataccccatctggtatt
aaagactccattccagcttggatcaagtattctgtccagccacctggcgagatcccatat
aatggagtatattatgaccctcctgaggaggataaatatgcgttcaaacatcctcgtcca
aagaaacccacatcgctgcgtatatatgaatcacatgttggaatgagtagtacggaacca
aagataaatacatatgccaactttagagatgatgtacttccccgtataaaaaagctaggc
tataatgctgtgcagataatggccattcaagagcatgcctactatgccagctttgggtat
catgtgacaaattttttcgcacctagcagccgctttggaacacctgatgaccttaaatct
ttgatagacaaagctcatgagctaggtctggttgttctgatggatattgtgcacagccat
gcatcaaaaaacacactggatggcctggacatgtttgatggtactgatggtcaatatttc
cactctggatcgcgtggttatcattggatgtgggattctcgtcttttcaattacggaagc
tgggaagtgcttaggtatcttctttccaacgcgagatggtggctggaagaatacaagttt
gatgggttcagatttgatggtgtgacttccatgatgtacactcatcatggactgcaggtc
gaatttactgggaattacaatgagtactttggatattctactgatgttgacgctgtggtc
tatctaatgctggtgaacgatttgattcatgggctataccctgaggctattgttgtcggc
gaagatgttagcgggatgccagctttttgcgttcctgtcgaagacggtggtgtgggtttt
gactaccgtctacacatggcagtggcagataaatggattgagcttcttaagaagagagac
gaggactggcaggttggtgatataactttcacgcttaccaacaggaggtggggagaaaaa
tgtgtcgtctatgcagagagtcatgatcaagcccttgttggagacaaaacgatagctttc
tggctaatggataaggacatgtatgatttcatggccgttgatagacaggccactccgcgt
gtagaccgtgggattgctttacacaaaatgatccgtctcattacgatgggattgggtgga
gaaggatacctcaatttcatgggaaacgaatttggacacccagaatggatcgacttccca
aggaccgaccagcaccttcctgatggcagagtcatcgctgggaataatggtagttatgat
aaatgccgacgtaggtttgatctgggagatgcagaatatcttagataccatggactacaa
gagtttgatcgagcaatgcaaaatctagaggagacgtatggtttcatgacttcagagcac
cagtacatatcccgcaaggatgaaggagacagagtcattgtattcgagagaggtaacttg
ctcttcgtcttcaacttccactggaccaacagttactctgactaccgtatcggttgctct
gttcccggaaagtacaaaatcgttttggactctgataactctttatttggaggcttcaac
cggctagatgactccgcggagtttttcacctctgatggaaggcacgacgataggccttgc
tccttcatggtgtatgcaccgtgcagaaccgctgtagtttacgctgcagtagatgatgat
gatgatgatgaacgttcttctcttgtccccataggcctgttacccgaagatgtttag

DBGET integrated database retrieval system