KEGG   Arabidopsis thaliana (thale cress): AT2G37470Help
Entry
AT2G37470         CDS       T00041                                 

Definition
(RefSeq) Histone superfamily protein
  KO
K11252  histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    AT2G37470
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT2G37470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 818324
NCBI-ProteinID: NP_181283
MIPS: AT2G37470.1
TAIR: AT2G37470
Araport: AT2G37470
UniProt: Q9ZUS0 A0A178VMX3 Q0WS50
Position
2
AA seq 138 aa AA seqDB search
MAPKAAEKKPAEKKPAGKAPAEKLPKAEKKISKDAGGSEKKKKKSKKSVETYKIYIFKVL
KQVHPDVGISGKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSREIQTAVRLVLPGE
LAKHAVSEGTKAVTKFTS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaaagcagcggagaagaaaccggcagagaagaaaccagccgggaaagctccg
gcggagaaactcccaaaggcggagaagaaaatcagcaaagacgccggaggaagcgagaag
aagaagaagaaatcgaagaagagcgtcgagacttacaagatctacatcttcaaggttctg
aaacaagttcatccagatgttggaatctctgggaaagctatggggattatgaacagtttc
atcaatgacatcttcgagaaacttgctcaggaatcgtcaaagctcgctaggtacaataag
aagccgacgattacatcgagggagattcaaaccgctgtgagacttgtgttgcctggagaa
ctcgctaaacatgcggtttctgaaggcacgaaggcggttaccaaattcaccagttag

DBGET integrated database retrieval system