KEGG   Arabidopsis thaliana (thale cress): AT2G38050Help
Entry
AT2G38050         CDS       T00041                                 

Gene name
DET2
Definition
probable steroid reductase DET2
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    AT2G38050 (DET2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     AT2G38050 (DET2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 262 aa AA seqDB search
MEEIADKTFFRYCLLTLIFAGPPTAVLLKFLQAPYGKHNRTGWGPTVSPPIAWFVMESPT
LWLTLLLFPFGRHALNPKSLLLFSPYLIHYFHRTIIYPLRLFRSSFPAGKNGFPITIAAL
AFTFNLLNGYIQARWVSHYKDDYEDGNWFWWRFVIGMVVFITGMYINITSDRTLVRLKKE
NRGGYVIPRGGWFELVSCPNYFGEAIEWLGWAVMTWSWAGIGFFLYTCSNLFPRARASHK
WYIAKFKEEYPKTRKAVIPFVY
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatcgccgataaaaccttcttccgatactgtctcctcactcttattttcgcc
ggcccaccaaccgccgtccttctgaaattcctccaagctccttacggtaaacacaaccgt
accggatggggtcccaccgtatctccaccgattgcttggttcgtcatggagagcccaacc
ttgtggctcactctcctcctcttcccctttggtcgtcacgctctcaaccctaaatctcta
cttctattctctccttatctcattcattacttccaccgcaccatcatttaccctcttcgc
ctcttccgcagctccttccccgccggtaaaaacggatttccgatcaccatcgccgccttg
gctttcacctttaatctcctcaatggttatatccaggcgaggtgggtttcgcattacaag
gatgactacgaagacggaaactggttctggtggcggtttgttatcggtatggtggttttc
ataaccggcatgtatataaatatcacgtcggaccggactttggtacgattgaagaaagag
aaccggggaggttatgtgataccgagaggaggctggttcgagttggtaagctgtccgaat
tattttggagaggcgattgagtggttgggctgggctgttatgacttggtcttgggccggt
attggattttttctgtacacgtgttccaatttgtttccgcgtgcacgtgcgagtcacaag
tggtacattgccaagttcaaggaagagtatcccaagactcgtaaagctgttattcctttt
gtgtactga

DBGET integrated database retrieval system