KEGG   Arabidopsis thaliana (thale cress): AT2G38380Help
Entry
AT2G38380         CDS       T00041                                 

Definition
peroxidase 22
Orthology
K00430  
peroxidase [EC:1.11.1.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Phenylalanine metabolism
Phenylpropanoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AT2G38380
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT2G38380
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     AT2G38380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 349 aa AA seqDB search
MGFSPSFSCSAIGALILGCLLLQASNSNAQLRPDFYFGTCPFVFDIIGNIIVDELQTDPR
IAASLLRLHFHDCFVRGCDASILLDNSTSFRTEKDAAPNANSARGFNVIDRMKVALERAC
PGRVSCADILTIASQISVLLSGGPWWPVPLGRRDSVEAFFALANTALPSPFFNLTQLKTA
FADVGLNRTSDLVALSGGHTFGRAQCQFVTPRLYNFNGTNSPDPSLNPTYLVELRRLCPQ
NGNGTVLVNFDVVTPDAFDSQYYTNLRNGKGLIQSDQELFSTPGADTIPLVNQYSSDMSV
FFRAFIDAMIRMGNLRPLTGTQGEIRQNCRVVNPRIRVVENDDGVVSSI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggggttttctccttcattttcttgcagtgctattggagccctaattttgggttgcctt
ctgcttcaagcatcaaactctaatgctcagttgaggcctgatttctacttcgggacgtgc
ccatttgtttttgatatcattggaaatatcatcgtcgatgaactgcagactgatcctcgt
attgccgcgagcctccttcgtcttcactttcacgactgctttgttcgtggttgtgatgca
tcgatcttgcttgacaattccacatcattccggactgagaaagatgctgctccgaacgca
aattcggctcgagggtttaatgtcatagatagaatgaaagtagcccttgagagagcttgc
ccaggaagagtctcttgtgcagatattctcaccatcgcctctcaaatatcagtgcttttg
tcgggaggtccatggtggccggttccgttggggaggagagacagtgtagaagctttcttc
gctctggctaatacagctctgccctctccgtttttcaatcttactcaacttaaaacagcc
tttgctgacgttggcctaaaccgcacttccgatctagttgctctttccggtggtcacaca
tttggaagagcacaatgccagttcgtgacgcctcgtctctacaacttcaatggtacaaac
agtccagacccaagtctgaacccaacttaccttgtcgaactccgtcgattgtgtcctcaa
aacggaaacggcaccgttctggtcaacttcgatgtcgtgactccagatgctttcgatagt
caatactacaccaaccttcgtaatgggaaaggtcttattcagagtgaccaggaactcttt
tcgactccaggagccgatacgatccctttagtaaaccaatacagcagcgacatgtccgtg
ttctttcgagcattcattgacgcaatgattaggatgggaaatcttagacctttgactgga
actcaaggagagattagacaaaattgtagggttgtgaatccacgaattagggttgtggag
aacgacgatggtgttgtgagttctatctga

DBGET integrated database retrieval system