KEGG   Arabidopsis thaliana (thale cress): AT2G38580Help
Entry
AT2G38580         CDS       T00041                                 

Definition
(RefSeq) ATP synthase D chain-related protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 482 aa AA seqDB search
MEDDKKKKRNKKKKNKQNNKRVDDALASGATTSVDENHIGDGDVPQISGGPDADESQSSH
QIDVVATEDDSGVENKSQGSEVLLEETIKQLREENGSYLQKEAGFEENVRRLETENEAHI
QKEALLEERLVHLKTENEAHVHNEALLEGKLLHLRTENEDHIQNEALLEEKLLHLRTENE
AHIQNEALLEERLLHFRTENEAHKQNEEKLEERLVQYKNKNDMLLREMSSTEAQMRQLLD
ERSTFTQKEASLEKKVQQLQHDEESLVAEEKSSREMISSLNNEIARLRAQVTELEKSKSN
LLEQNQSLKETISNLQVQHENHDSNAKGASEEELNSQIEAACTLVEKLITENADLVEKVN
ELCIKLNQSQHASPESLAIEVEKSESLEEIPIHDELIRIDNSRDMDTASIKRNFSEGEIE
ETVPLSLNANGEVDVESQVAVAGEDEINAGVPLADAPLIGAPFRLVSFVARYVSGADLAA
KK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgacaagaagaagaagagaaacaagaaaaagaagaataagcagaataataaa
cgtgttgacgacgctttagcttctggtgcaacgacctccgtcgatgaaaatcatatcgga
gatggtgacgttcctcaaattagcggaggtccagatgccgatgagtcgcaatcatctcat
cagatcgatgtcgtcgcaactgaagatgattctggtgttgagaacaagtctcagggaagt
gaggtgctgttggaagaaacaattaaacagttacgtgaggaaaatggttcctaccttcag
aaagaggctggttttgaagaaaatgttagacgcttggaaaccgagaatgaagctcacatt
cagaaagaggcattgttagaagaaaggcttgtacatttgaaaacagagaatgaagctcac
gtacataatgaggcactgttagaaggaaagctcttgcatttgagaacagagaatgaagat
cacatacagaatgaggcactgttagaagaaaagctcttgcatttgagaacagagaatgaa
gctcacatacaaaatgaggcactgttggaagaaaggctcttacattttagaactgaaaat
gaagctcacaaacaaaacgaagaaaagttggaggaaagacttgtgcagtataaaaacaag
aacgacatgcttcttcgtgaaatgtctagcacagaagcccagatgagacaattgctagat
gaaagatctaccttcactcagaaagaggcgagtctagaaaagaaagttcaacaacttcaa
cacgatgaagaatccttggtggctgaggagaagtcatccagagaaatgatatctagcctt
aacaatgaaattgcaaggctgcgagcacaggttacggagttggaaaaatctaagagtaat
cttctagagcagaatcagagtcttaaggaaactatatccaatcttcaagtccagcatgaa
aaccatgatagtaacgcaaagggtgcttctgaggaagaattaaactcacagattgaagca
gcttgtactctagttgaaaagcttatcactgaaaatgctgatctagttgaaaaggtgaac
gaattgtgtattaagctaaaccaatcacagcatgcttcccctgagagcctagcaattgaa
gtagagaaatctgaatccttagaagaaatacccatacacgacgagttgattagaattgat
aactctagggacatggatactgcatcaataaagagaaacttttcagaaggtgaaatagaa
gaaacggtgccgctctctctgaacgcgaatggggaagtagacgtggaatcacaggttgca
gtagctggagaagacgaaataaatgctggtgtgcctctggcggacgctccacttatcggt
gctccattcaggctcgtctcgtttgtagcaagatacgtgagtggtgcagatttggcggca
aagaaatag

DBGET integrated database retrieval system