KEGG   Arabidopsis thaliana (thale cress): AT2G39730Help
Entry
AT2G39730         CDS       T00041                                 

Gene name
RCA
Definition
(RefSeq) ribulose bisphosphate carboxylase/oxygenase activase
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
2
AA seq 474 aa AA seqDB search
MAAAVSTVGAINRAPLSLNGSGSGAVSAPASTFLGKKVVTVSRFAQSNKKSNGSFKVLAV
KEDKQTDGDRWRGLAYDTSDDQQDITRGKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR
QYNLDNMMDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGIWGGKGQGKSFQCELVMA
KMGINPIMMSAGELESGNAGEPAKLIRQRYREAADLIKKGKMCCLFINDLDAGAGRMGGT
TQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENARVPIICTGNDFSTLYAPLIRDGRM
EKFYWAPTREDRIGVCKGIFRTDKIKDEDIVTLVDQFPGQSIDFFGALRARVYDDEVRKF
VESLGVEKIGKRLVNSREGPPVFEQPEMTYEKLMEYGNMLVMEQENVKRVQLAETYLSQA
ALGDANADAIGRGTFYGKGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcagtttccaccgtcggtgccatcaacagagctccgttgagcttgaacggg
tcaggatcaggagctgtatcagccccagcttcaaccttcttgggaaagaaagttgtaact
gtgtcgagattcgcacagagcaacaagaagagcaacggatcattcaaggtgttggctgtg
aaagaagacaaacaaaccgatggagacagatggagaggtcttgcctacgacacttctgat
gatcaacaagacatcaccagaggcaagggtatggttgactctgtcttccaagctcctatg
ggaaccggaactcaccacgctgtccttagctcatacgaatacgttagccaaggccttagg
cagtacaacttggacaacatgatggatgggttttacattgctcctgctttcatggacaag
cttgttgttcacatcaccaagaacttcttgactctgcctaacatcaaggttccacttatt
ttgggtatatggggaggcaaaggtcaaggtaaatccttccagtgtgagcttgtcatggcc
aagatgggtatcaacccaatcatgatgagtgctggagagcttgagagtggaaacgcagga
gaacccgcaaagcttatccgtcagaggtaccgtgaggcagctgacttgatcaagaaggga
aagatgtgttgtctcttcatcaacgatcttgacgctggtgcgggtcgtatgggtggtact
actcagtacactgtcaacaaccagatggttaacgcaacactcatgaacattgctgataac
ccaaccaacgtccagctcccaggaatgtacaacaaggaagagaacgcacgtgtccccatc
atttgcactggtaacgatttctccaccctatacgctcctctcatccgtgatggacgtatg
gagaagttctactgggccccgacccgtgaagaccgtatcggtgtctgcaagggtatcttc
agaactgacaagatcaaggacgaagacattgtcacacttgttgatcagttccctggtcaa
tctatcgatttcttcggtgctttgagggcgagagtgtacgatgatgaagtgaggaagttc
gttgagagccttggagttgagaagatcggaaagaggctggttaactcaagggaaggacct
cccgtgttcgagcaacccgagatgacttatgagaagcttatggaatacggaaacatgctt
gtgatggaacaagagaatgtcaagagagtccaacttgccgagacctacctcagccaggct
gctttgggagacgcaaacgctgacgccatcggccgcggaactttctacggaaaaggagcc
cagcaagtaaacctgccagttcctgaagggtgtactgatcctgtggctgaaaactttgat
ccaacggctagaagtgacgatggaacctgtgtctacaacttttga

DBGET integrated database retrieval system