KEGG   Arabidopsis thaliana (thale cress): AT2G40000Help
Entry
AT2G40000         CDS       T00041                                 

Gene name
HSPRO2
Definition
(RefSeq) HS1 PRO-1 2-like protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 435 aa AA seqDB search
MVDMDWKRKMVSSDLPNSPKLSSKLHVTIPSPFKIVPVSSPISCSAPALCSAYELYLRLP
ELRKLWSSRDFPQWTSEPILKPALQALEISFRLVFAVCSDTRPYINHREWNRRLDSLITK
QIQLVAAICEDEEEEGISAEAPVGGGRSSLSLLPQLATWRRSEALGKKILYTIDNEMSRC
KYTLGLGEQNIAGKPNLRYDAICRPNEIYSLKDNPYADHIDNHENQTLYIIHQILESWIY
ASGNLLNRIVSSIEEEKFGKASNDVYLLEKIWKILAEIEDLHMLMDPEDFLKLKKQLQIK
STGKNDAFCFRSKGLVEMMKMSKDLRQKVPAVLAVEVDPTGGPRLQEAAMKLYARKTECD
KIHLLQGMQAVEAAAKSFFFGYRQLVAAMMGSAEMNATASQESCDSLSQIFMEPTYFPSL
DAAKTFLGEFWSHLG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggttgatatggattggaagaggaagatggtatcatcagatttaccaaactcacctaag
ctttcttcaaagcttcacgtaactattccatcaccgttcaaaatcgtccctgtttcatct
ccgatctcatgttcagcacctgctctttgctctgcttacgagctttaccttcgtctccct
gagctaagaaagctctggtcatctcgtgattttcctcaatggacatcagagccgattctc
aaaccagctcttcaagctttggagatcagtttcagattagttttcgccgtttgttctgat
actagaccgtacatcaaccaccgtgaatggaaccggaggctagattctctcatcacgaag
cagatccagcttgtagcagcgatctgcgaagatgaagaagaagaaggtatatcagcggag
gctccggtcggcggtggacggagttcgttgagtttgttaccgcagctagctacgtggagg
agatcagaggctttggggaagaagatcttatatacgatcgataacgagatgagtcggtgt
aagtacacgctcggactcggtgaacaaaacatcgccggaaaaccaaatctccggtacgat
gcgatttgccgaccaaacgagatctatagcctcaaggataatccatacgcagatcatatc
gataatcacgagaatcaaactctctatatcattcaccagatcctcgaatcgtggatctac
gcatctggaaatcttctgaatcgaatcgtctcaagtatcgaagaagagaaattcggaaaa
gcttcaaacgatgtttacttgctggagaagatctggaaaattttagcggagattgaagat
cttcatatgttgatggatccggaagattttttgaaattgaagaaacagttacagatcaaa
tcgacgggtaaaaacgatgcgttttgtttcagatctaaaggattagtggagatgatgaag
atgtcgaaagatctgagacagaaagtaccggcggtcttggcggttgaggtagatccaacc
ggaggaccaagattacaagaggcggcgatgaagctttacgcgaggaagacagagtgcgat
aagattcatttgcttcaggggatgcaagcggtggaagcggcggcgaagagtttcttcttt
gggtataggcagttagtggcggctatgatgggaagtgcggagatgaacgcgacggcgagt
caagagtcgtgtgactcactgagtcagatatttatggagccgacgtatttcccgagcctt
gacgcggcaaagacgtttctgggagagttttggagtcatttgggatga

DBGET integrated database retrieval system