KEGG   Arabidopsis thaliana (thale cress): AT2G40220Help
Entry
AT2G40220         CDS       T00041                                 

Gene name
ABI4
Definition
(RefSeq) ethylene-responsive transcription factor ABI4
  KO
K09286  
EREBP-like factor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Other transcription factors
   EREBP
    AT2G40220 (ABI4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 328 aa AA seqDB search
MDPLASQHQHNHLEDNNQTLTHNNPQSDSTTDSSTSSAQRKRKGKGGPDNSKFRYRGVRQ
RSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQLNLTPSSPSSVSS
SSSSVSAASSPSTSSSSTQTLRPLLPRPAAATVGGGANFGPYGIPFNNNIFLNGGTSMLC
PSYGFFPQQQQQQNQMVQMGQFQHQQYQNLHSNTNNNKISDIELTDVPVTNSTSFHHEVA
LGQEQGGSGCNNNSSMEDLNSLAGSVGSSLSITHPPPLVDPVCSMGLDPGYMVGDGSSTI
WPFGGEEEYSHNWGSIWDFIDPILGEFY
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaccctttagcttcccaacatcaacacaaccatctggaagataataaccaaacccta
acccataataatcctcaatccgattccaccaccgactcatcaacttcctccgctcaacgc
aaacgcaaaggcaaaggtggtccggacaactccaagttccgttaccgtggcgttcgacaa
agaagctggggcaaatgggtcgccgagatccgagagccacgtaagcgcactcgcaagtgg
cttggtactttcgcaaccgccgaagacgccgcacgtgcctacgaccgggctgccgtttac
ctatacgggtcacgtgctcagctcaacttaaccccttcgtctccttcctccgtctcttcc
tcttcctcctccgtctccgccgcttcttctccttccacctcctcttcctccactcaaacc
ctaagacctctcctccctcgccccgccgccgccaccgtaggaggaggagccaactttggt
ccgtacggtatcccttttaacaacaacatcttccttaatggtgggacctctatgttatgc
cctagttatggttttttccctcaacaacaacaacaacaaaatcagatggtccagatggga
caattccaacaccaacagtatcagaatcttcattctaatactaacaataacaagatttct
gacatcgagctcactgatgttccggtaactaattcgacttcgtttcatcatgaggtggcg
ttagggcaggaacaaggaggaagtgggtgtaataataatagttcgatggaggatttgaac
tctctagctggttcggtgggttcgagtctatcaataactcatccaccgccgttggttgat
ccggtatgttctatgggtctggatccgggttatatggttggagatggatcttcgaccatt
tggccttttggaggagaagaagaatatagtcataattgggggagtatttgggattttatt
gatcccatcttgggggaattctattaa

DBGET integrated database retrieval system