KEGG   Arabidopsis thaliana (thale cress): AT2G40840Help
Entry
AT2G40840         CDS       T00041                                 

Gene name
DPE2
Definition
4-alpha-glucanotransferase DPE2
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ath00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 955 aa AA seqDB search
MMNLGSLSLSTSKSSKPMVSISFWIPYFTHWGESLLVCGSAPGLGSGNVKKGLLLKPSQQ
DDQLIWSGSVSVPPGFSSDYCYYVVDDSKSVLRSEFGMKRKLVVPETLTGGESVHLRDLW
QSGDQALPFRSAFKDVIFHHSFDVKVEKPLGVFMNKSDQDDSVVVQFKICCPDIGEGTSV
YVLGTPEKLGNWKVENGLRLNYVDDSIWEADCLIPKADFPIKYRYCKVQKEDSIGFESGG
NRELSLHSIGSKQEYIVMSDGLFRAMPWRGAGVAVPMFSVRSEDDVGVGEFLDLKLLVDW
AVDSGLHLVQLLPVNDTSVHKMWWDSYPYSSLSVFALHPLYLRVQALSERLPEDIKEEIQ
KAKNQLDKNDVDYEATMETKLSIAKKIFDIEKDQTLNSSTFQKFFSENEGWLKPYAAFCF
LRDFFETSDHSQWGTFSDYTDDKLEKLISKDNLHYNTICFHYYIQYHLHVQLSAAAEYAR
KKGVVLKGDLPIGVDRNSVDTWVYRNLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSK
DNYAWWRARLTQMGKYFTAYRIDHILGFFRIWELPAHAMTGLVGKFRPSIPLSQEELEKE
GIWDFDRLSKPYIQKKFLEEKFGDFWPFIASNFLNETQKDMYEFKEDCNTEKKIVAKLKS
LAEKSLLLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNIEDTSSFQDLDDHSKNVL
KRLYYDYYFQRQEDLWRKNALKTLPALLNSSNMLACGEDLGLIPSCVHPVMQELGLVGLR
IQRMPSESDVKFGIPSNYDYMTVCAPSCHDCSTLRAWWEEDEERRQQYFKEVIGVDGIPP
SQCIPEITHFILRQHVEAPSMWAIFPLQDMMALKEEYTTRPATEETINDPTNPKHYWRYR
VHVTLDSLLKDTDLKSTIKNLVSSSGRSVPANVSGEDINKSRGEVIANGSTKPNP
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatctaggatctctttcgttgagtacgagcaagtcgagtaagccaatggttagc
atcagcttttggataccgtatttcactcactggggagagagcctgctggtctgtggctcg
gctcctggacttggttccgggaatgtgaaaaaaggtttgctgctaaagccatcccagcaa
gatgatcagctcatctggagtggctctgtctcggttccacctgggtttagctctgactat
tgttactatgtggtggatgactcgaagagtgtgttaaggtcggagtttgggatgaaacga
aaacttgtggtgcctgagacattgaccggtggagagtctgttcatcttcgtgatctctgg
cagagtggggatcaagctcttccatttagaagtgcatttaaagatgtcatcttccaccac
agtttcgatgtgaaagtagaaaaacctctaggggtctttatgaataagtcagatcaagat
gattcagttgttgtccaattcaaaatctgttgtccagacattggagagggaacatctgtg
tatgttctaggcaccccagaaaagttggggaattggaaagttgaaaatggacttagactc
aactatgtcgatgattccatatgggaagcagattgcttgatccctaaagcagactttcct
atcaaatatagatactgtaaagttcagaaggaagatagcatagggtttgaatctggtggt
aatcgggagctgtctcttcactccatcggtagtaaacaggaatacattgtcatgtcagat
ggcttgtttcgagcaatgccatggaggggtgctggtgtagcagttcccatgttctctgta
aggtcagaagatgatgttggtgtgggagagtttctcgatctgaagttgcttgttgattgg
gctgtagattccgggttgcatctagtacaacttttaccagtaaatgacacatccgttcat
aagatgtggtgggactcgtatccctacagctcgttatctgtgtttgcattgcatccatta
tatcttagagtgcaggctctctctgaacgtctgccagaagatatcaaggaagaaattcag
aaggcgaagaatcaactggacaagaatgatgttgattatgaggctaccatggaaactaag
ctttcaattgccaagaaaatctttgacatagagaaagaccagactttgaactcaagcacc
ttccagaaattcttctctgaaaacgagggctggttgaaaccatatgcagctttctgcttc
cttcgtgacttttttgagacttcagatcatagtcagtgggggaccttttctgactataca
gacgacaagcttgaaaaattgatatccaaggacaacttgcactataacactatatgcttc
cactactacattcagtaccatttacatgtacaattgtcagcagcagcagaatatgcaagg
aagaaaggagttgtgctgaaaggagacctacctattggcgttgacagaaacagtgttgat
acgtgggtttacaggaatctgtttcgcatgaatacgtcaactggagcacctccagactat
tttgacaaaaatggtcagaactggggatttcctacttataactgggaggaaatgtcaaaa
gacaactatgcctggtggcgtgctcgcctaacacagatggggaaatatttcacagcatac
aggattgatcatatattgggattcttcagaatctgggagcttccagctcatgctatgact
ggtttagtggggaagttccgtccatctattcctttaagtcaggaagagttggaaaaggag
ggaatatgggattttgaccgcttaagcaagccctatatccagaagaagtttcttgaggag
aaatttggagatttttggccttttattgcatcaaactttcttaatgaaactcagaaggac
atgtatgagttcaaggaggactgcaacacagagaagaagattgtagcaaagctgaagtca
ttggctgagaagtctttgttgctagaaaatgaggacaaagttcgacgtgatgtctttgac
attttacggaatgttgttctgatcaaagatccagaggatgcaagaaaattctatcctcgc
tttaatattgaggatacttcaagcttccaggatttggatgatcacagcaaaaatgttctg
aagaggctatactatgactactatttccaacgccaagaggatctatggagaaaaaatgct
ttgaaaaccttgcctgctctgttgaattcatctaatatgctggcatgtggggaggatctg
ggtctcattccatcttgtgtacatcctgttatgcaagaactgggattggttggccttcgc
atccagcgcatgccaagtgagtccgatgtgaagtttgggattccgtctaattatgactat
atgacggtgtgtgctccttcatgccacgactgctctaccctgcgagcttggtgggaagag
gacgaagagagaagacagcagtacttcaaggaagtgattggtgtagatggaatccctcca
agtcagtgtattccagagataactcatttcattctgaggcaacatgttgaagctccatca
atgtgggctattttcccgcttcaggatatgatggctctgaaagaagagtacactactcgt
cctgcaacagaggagacaatcaatgatccaacaaaccccaaacactactggagataccgc
gtacacgtgactttggactcgcttctaaaggacactgacctgaagtcaaccatcaagaac
ctcgtttccagcagtggaagatctgttcctgctaatgtttctggtgaagacatcaacaaa
agccgaggagaagttatagccaatggctcgactaagccaaacccataa

DBGET integrated database retrieval system