KEGG   Arabidopsis thaliana (thale cress): AT2G40890Help
Entry
AT2G40890         CDS       T00041                                 

Gene name
CYP98A3
Definition
(RefSeq) cytochrome P450 98A3
  KO
K09754  
coumaroylquinate(coumaroylshikimate) 3'-monooxygenase [EC:1.14.13.36]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Phenylpropanoid biosynthesis
Flavonoid biosynthesis
Stilbenoid, diarylheptanoid and gingerol biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Monolignol biosynthesis, phenylalanine/tyrosine  => monolignol
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT2G40890 (CYP98A3)
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    AT2G40890 (CYP98A3)
   00941 Flavonoid biosynthesis
    AT2G40890 (CYP98A3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.36  5-O-(4-coumaroyl)-D-quinate 3'-monooxygenase
     AT2G40890 (CYP98A3)
Cytochrome P450 [BR:ath00199]
 Cytochrome P450, plant type
  CYP98 family
   AT2G40890 (CYP98A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 508 aa AA seqDB search
MSWFLIAVATIAAVVSYKLIQRLRYKFPPGPSPKPIVGNLYDIKPVRFRCYYEWAQSYGP
IISVWIGSILNVVVSSAELAKEVLKEHDQKLADRHRNRSTEAFSRNGQDLIWADYGPHYV
KVRKVCTLELFTPKRLESLRPIREDEVTAMVESVFRDCNLPENRAKGLQLRKYLGAVAFN
NITRLAFGKRFMNAEGVVDEQGLEFKAIVSNGLKLGASLSIAEHIPWLRWMFPADEKAFA
EHGARRDRLTRAIMEEHTLARQKSSGAKQHFVDALLTLKDQYDLSEDTIIGLLWDMITAG
MDTTAITAEWAMAEMIKNPRVQQKVQEEFDRVVGLDRILTEADFSRLPYLQCVVKESFRL
HPPTPLMLPHRSNADVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPFEFRPERFLEEDVD
MKGHDFRLLPFGAGRRVCPGAQLGINLVTSMMSHLLHHFVWTPPQGTKPEEIDMSENPGL
VTYMRTPVQAVATPRLPSDLYKRVPYDM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtttctaatagcggtggcgacaatcgccgccgtcgtatcctacaagctaatc
caacggctaagatacaagttcccaccaggcccaagccccaagccgatcgtcggtaacctc
tacgacataaaaccggtccggttcagatgttactacgagtgggctcaatcttatggacca
atcatatcggtctggatcggttcaattctaaacgtggtcgtatctagcgccgagctagca
aaagaagttctgaaagaacacgaccagaaactcgccgaccggcaccggaacagatcgacg
gaagcatttagccgcaacggtcaggatcttatatgggccgattatgggcctcattacgtg
aaggtgagaaaagtttgcacgcttgagctcttcacaccgaaacgactcgagtctctcaga
cctatccgtgaagatgaagtcaccgccatggttgaatccgtcttcagagactgtaacctt
cctgaaaacagagcaaaaggtttacaactgaggaagtacttaggagcggttgcgttcaac
aacataacgcggctagcctttgggaagcgttttatgaacgctgaaggtgttgtggacgag
caagggcttgagttcaaggccatagtatccaacggtctgaagctaggtgcttcactgtca
atagctgaacacatcccgtggctcaggtggatgtttccggctgatgagaaggcgtttgct
gagcacggggctcgtcgtgaccgcctcactcgagctatcatggaggagcatactttggcc
cgtcaaaagtctagtggagcgaaacagcatttcgttgatgcgttgctaacgttgaaggat
cagtatgatcttagtgaggatactatcattggtcttctatgggatatgatcacggcaggg
atggacacgacagcgataacagcggaatgggcgatggcggaaatgatcaagaatccaaga
gtgcaacaaaaagtgcaagaagagttcgacagagtggttggacttgaccggatcttaacc
gaggcagatttctcccgcttaccttacttgcaatgcgtggtgaaagagtcattcaggctg
catcctccaacgcctctaatgctacctcaccgaagcaacgcagatgtcaagatcggaggc
tatgatattcccaaaggatcaaacgttcatgtgaatgtgtgggctgtggctagagacccg
gctgtatggaaaaatccatttgagtttagaccagagagattcttggaagaagatgttgac
atgaagggtcatgattttaggctgcttccgtttggagctggaagacgggtttgtcccggt
gcacaacttggtatcaatttggtaacttcgatgatgagtcatttgcttcaccattttgtt
tggacacctcctcaagggactaaaccggaggagattgacatgtctgaaaaccctggactc
gttacttacatgcgtacccctgtgcaagcggttgcaacgcctcggttgccttcggatctg
tacaaacgcgtgccttacgatatgtaa

DBGET integrated database retrieval system