KEGG   Arabidopsis thaliana (thale cress): AT2G40930Help
Entry
AT2G40930         CDS       T00041                                 

Gene name
UBP5
Definition
ubiquitin-specific protease 5
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 924 aa AA seqDB search
MAEVSMGSSSSSTDLSPEEERVFIRDIAIAAEANSKEGDTFYLITQRWWQEWIEYVNQDQ
PCNTNDGSSLSEHCDSPGSSTLKKPSRIDNSDLIYDSSLEDPSNTSEIIETLQEGRDYVL
LPQEVWNQLRSWYGGGPTLARRVISSGLSQTELAVEVYPLRLQLLLMPKSDHSAIRISKK
ETIRELHRRACEIFDLDSEHVRIWDYYGHQKYSLMNDLDKTLDDANLQMDQDILVEVLDI
NGTLSSAHIQSAQENGLVDGDSTSILIEPSKSSLAAAGGFSSSRNAFRTGSVEVSQSFDN
TYSSTGVTTRGSTAGLTGLLNLGNTCFMNSAIQCLVHTPEFASYFQEDYHQEINWQNPLG
MVGELALAFGDLLRKLWAPGRTPIAPRPFKAKLARFAPQFSGYNQHDSQELLAFLLDGLH
EDLNRVKHKPYINSRDADGRPDEEVADEFWKNHIARNDSIIVDVCQGQYKSTLVCPICNK
VSVTFDPFMYLSLPLQFNTTRAITVTVFSCDKTALPSTITVNVSKQGRCRDLIQALTNAC
SLKQSEELKLAEIRNNFIHRLFEDPLIPLSSIKDDDHLAAYKLSKSSENTTLLRLVLRRR
DQKAGERESTVQLKPCGTPLLSSASCGDALTKGKIHCLVQNMLSPFRREESVGKKGNSDS
SIPERRSARFNNTEEEDKVGGLKKAKKSNSSDLGASKLSLQLIDEDNKTINLPDNEAEAM
KLPSSATVTIYLDWTPELSGMYDITCLESLPEVLKYGPTTKKARSEPLSLYACLEAFLRE
EPLVPDEMWFCPQCNERRQASKKLDLWRLPEVLVIHLKRFSYSRSMKHKLETFVNFPIHD
LDLTKYVANKNLSQPQLYELYALTNHYGGMGSGHYTAHIKLLDDSRWYNFDDSHISHINE
DDVKSGAAYVLFYRRKSDAGGKMT
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtatcgatgggaagcagcagtagcagcacggatctgtctcccgaggaagag
cgagttttcatcagagacattgctattgctgctgaggctaatagtaaagaaggcgataca
ttttatctcatcactcagagatggtggcaagaatggattgagtatgtgaatcaagaccaa
ccatgtaacacaaatgatgggtcttcactgtcagagcattgcgactctcctggttcaagc
actctaaagaagccttctaggattgataactctgatttgatctatgattcttcgctggag
gacccgagtaataccagtgagattattgaaacacttcaggaaggtcgtgattatgttttg
ctccctcaagaagtgtggaaccaattgcgttcatggtacgggggtggtccaactctggca
cggagagtcattagctcaggtctctctcaaacagaattggctgtagaggtttacccttta
cgtcttcagctacttctgatgccaaaaagtgaccatagtgccataagaattagcaaaaag
gaaactatcagagagctccatcgaagagcctgtgaaatttttgacctcgactcagagcat
gtacgcatttgggattactacggccaccaaaagtattctttgatgaatgacttagataag
acactggacgatgctaacctacaaatggatcaggatattttggtggaggtgcttgacatc
aatggtacattatcaagtgctcacattcaatctgctcaagagaacggattggtggatgga
gactctacttctattctcattgagccttctaaatcgagcttggctgccgcaggagggttc
tcttcaagcaggaatgcattcagaactggtagtgtagaagtttcacaatcttttgataac
acatacagtagcactggcgtcaccactaggggatccacagctggcttgacagggctgcta
aatcttgggaatacttgtttcatgaatagtgcgattcagtgtctggttcatacacctgag
tttgctagttactttcaagaagattatcatcaagaaataaattggcaaaaccctcttgga
atggtgggggaattagctctcgcatttggtgacttgctcaggaagttatgggctcctggg
cggacaccaattgcacctcgtccattcaaagctaaacttgctcgctttgctcctcaattt
agtgggtacaatcaacatgattcgcaggagcttttagcgtttctgctggatggtcttcac
gaggacctaaatcgtgttaaacacaaaccatatataaattctcgagacgcagatgggcgc
cctgatgaagaagttgctgatgagttctggaaaaatcatattgctcgtaatgactcaata
atagttgatgtttgtcagggccaatataagtcaacattggtgtgtccaatctgcaacaag
gtttctgtaacgtttgatcccttcatgtacctgtctttgccgctgcagttcaacacaaca
cgagcaataacagtcacagttttttcttgtgataaaactgccttaccttccactatcaca
gtcaatgtttcaaagcagggacgttgcagagacttgatccaggcattaacaaatgcttgt
tccttgaagcaaagtgaagagctgaaacttgcagagattcggaataattttatccataga
ttatttgaagaccctttaattccgttgtcaagtatcaaagatgatgaccaccttgctgca
tacaaactttcaaagtcttcggagaatacgactttgcttagactagtactccgccgcaga
gatcagaaagctggggaacgtgaaagtacagtacaattgaaaccctgtggaacacctctt
ctctcatcagcttcatgcggagatgcactcaccaaaggaaaaatccattgcctcgtccag
aatatgctttcaccttttcggagggaagaatctgtgggcaaaaaaggaaattctgattct
agcatccccgagagaaggtcagctcgatttaataatactgaggaagaagataaagttggt
ggactgaaaaaagccaagaaaagcaactcctccgacttgggtgcttctaaattatccctg
caactcattgatgaagacaacaaaacgattaatctgccagacaatgaagcagaagctatg
aaattaccgtcatcagctactgtaactatatatttggattggacaccagaactctctggt
atgtatgatataacttgcctggagagtttgcctgaagtactcaaatacggacctactacc
aagaaggctcgttcagaacctctttctttatatgcatgtttggaagcgtttctacgcgaa
gagcctttggtacctgacgaaatgtggttctgtccacaatgcaatgaaagaaggcaggca
agcaaaaagcttgatctgtggaggcttcctgaggtcttagtcatacatctaaagagattc
tcatacagcaggtccatgaagcataagttggaaacatttgttaactttcccattcatgac
ttagatctaacaaagtatgtagccaacaaaaacctatctcaacctcaactatatgagctc
tatgccttgaccaaccattatggtggtatgggcagcggacactacactgcacatatcaag
cttttggacgacagtaggtggtataacttcgatgatagccatatatcacacataaacgaa
gatgatgtgaagtcaggtgctgcatatgtgctcttctacaggaggaagtctgatgcaggc
ggaaaaatgacataa

DBGET integrated database retrieval system