KEGG   Arabidopsis thaliana (thale cress): AT2G41860Help
Entry
AT2G41860         CDS       T00041                                 

Gene name
CPK14
Definition
(RefSeq) calcium-dependent protein kinase 14
  KO
K13412  
calcium-dependent protein kinase [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    AT2G41860 (CPK14)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT2G41860 (CPK14)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: CAMK group
  CDPK family
   AT2G41860 (CPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 530 aa AA seqDB search
MGNCCGTAGSLIQDKQKKGFKLPNPFSNEYGNHHDGLKLIVLKEPTGHEIKQKYKLGREL
GRGEFGVTYLCTEIETGEIFACKSILKKKLKTSIDIEDVKREVEIMRQMPEHPNIVTLKE
TYEDDKAVHLVMELCEGGELFDRIVARGHYTERAAASVIKTIIEVVQMCHKHGVMHRDLK
PENFLFANKKETASLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLRRSYGQEIDIWSA
GVILYILLCGVPPFWAETEHGVAKAILKSVIDFKRDPWPKVSDNAKDLIKKMLHPDPRRR
LTAQQVLDHPWIQNGKNASNVSLGETVRARLKQFSVMNKLKKRALRVIAEHLSVEETSCI
KERFQVMDTSNRGKITITELGIGLQKLGIVVPQDDIQILMDAGDVDKDGYLDVNEFVAIS
VHIRKLGNDEHLKKAFTFFDKNKSGYIEIEELRDALADDVDTTSEEVVEAIILDVDTNKD
GKISYDEFATMMKTGTDWRKASRQYSRDLFKCLSLKLMQDGSLQSNGDTK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattgttgtggaacggctggatcgttgattcaagataagcagaagaaaggtttt
aaattgccaaatcctttctcaaacgagtacggcaaccaccacgatggccttaagcttatc
gtgttgaaggaaccaacgggtcatgagatcaagcagaaatataaattaggtcgtgagtta
ggtcgaggagagttcggtgtgacgtatctgtgcaccgagatcgagaccggagagattttc
gcatgcaaatcaatcttaaagaagaagctgaaaacgtcgattgatatagaggacgttaag
agagaagttgagatcatgaggcaaatgcctgaacatcctaatattgttactttgaaagag
acttatgaggatgataaagctgtgcatttggttatggagctttgtgaaggcggtgagctt
ttcgataggattgttgctagagggcattatacggagagagctgctgcttcggttattaaa
acgatcatcgaggttgttcagatgtgtcataagcatggagtaatgcacagagatttaaaa
cctgagaacttcttgtttgcaaacaagaaggaaactgcatctttgaaggctattgatttt
ggtctctctgttttctttaaaccaggcgagagatttaacgaaattgttgggagtccttac
tacatggctcctgaggtattaaggaggagttatggacaagaaattgacatttggagcgca
ggagtgattctttacatattgctctgtggtgttccacctttttgggcagaaaccgaacat
ggagtcgcaaaagcaattcttaaatctgtaattgactttaaaagagacccctggcctaaa
gtttctgataatgcaaaagatctgatcaaaaagatgcttcatcctgatccaaggcgtcgt
ctaactgctcaacaagtgcttgatcatccgtggatacagaatggtaagaatgcttccaat
gtatcattgggtgaaaccgtaagagcaaggcttaagcaattctctgttatgaacaagctc
aagaaaagggcactcagggttatcgctgagcatctatcggttgaagaaacatcttgcata
aaagaaagattccaagtaatggatacaagcaatagaggaaagattactatcaccgagcta
ggaatcggattgcagaaactcgggattgttgttcctcaagatgacattcaaatattgatg
gacgcgggagatgttgataaagatggatatttagacgtcaatgaatttgtagccatatcg
gtacacatcaggaagttaggcaacgacgagcacttaaagaaagcttttacgttctttgac
aaaaacaagagtggttatatcgaaatagaggagttaagagatgctttggcagatgatgtt
gacactactagtgaagaagttgttgaagccattattcttgatgtcgataccaataaggat
gggaaaataagttacgacgaatttgcaacgatgatgaaaacgggaacggattggagaaaa
gcttcgaggcagtactcgagggacctgtttaagtgtcttagtcttaagctcatgcaagat
gggtccttgcagtctaatggagatacaaagtag

DBGET integrated database retrieval system