KEGG   Arabidopsis thaliana (thale cress): AT2G42800Help
Entry
AT2G42800         CDS       T00041                                 

Gene name
RLP29
Definition
(RefSeq) receptor like protein 29
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 462 aa AA seqDB search
MTMKRALPSPSSLLFFFLLITPLFLCQENRVSASMPPSESETLFKIMESMSSDQQWRQSH
PNPCAPGSSWPGIECKTGPDHLSHVSRLDFGSAPNPSCKSSASFPSSIFTLPFLQSVFFF
NCFTHFPTTIMFPIKLIPNSSLQQLSLRSNPSLSGQIPPRISSLKSLQILTLSQNRLTGD
IPPAIFSLKSLVHLDLSYNKLTGKIPLQLGNLNNLVGLDLSYNSLTGTIPPTISQLGMLQ
KLDLSSNSLFGRIPEGVEKLRSLSFMALSNNKLKGAFPKGISNLQSLQYFIMDNNPMFVA
LPVELGFLPKLQELQLENSGYSGVIPESYTKLTNLSSLSLANNRLTGEIPSGFESLPHVF
HLNLSRNLLIGVVPFDSSFLRRLGKNLDLSGNRGLCLNPEDEFSVVKTGVDVCGKNVSSG
GGLSVHSSKKKSQASRYYRSCFFANALFPFALFLGLHQRWVL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaagagagctttaccatctccttcctcactgctcttcttctttctcctgata
acaccactcttcctctgccaagaaaacagagtctctgcctcaatgcctccatctgagtca
gaaactctcttcaagatcatggaatcaatgtcttctgatcaacaatggcgtcaatcccac
ccaaacccttgtgcacctggctcatcttggccaggcattgagtgcaaaaccggtccagac
cacttatcacacgtctctcgactcgatttcggctctgctccaaacccctcttgtaaatcc
tctgcttctttcccttcttcaatcttcactctcccttttctccaatcagtcttcttcttc
aactgcttcactcacttcccaaccacaatcatgttccctataaaactcatccctaactct
tctcttcaacaacttagcctcagatcaaacccttctctctcaggtcaaatccctcctcgc
atttcttctctcaaatctttacaaatcctcactctctcacaaaaccgattaaccggagat
atccctccggcgattttctcattgaaaagcctcgtacacctcgatctcagctacaacaag
ctcacaggtaaaatccctctgcaattagggaatctaaataacctcgttggcttagattta
agctacaattctttaaccggtacaatccctccaacgatctctcaactgggtatgcttcag
aaactcgacttgagctcaaattctctcttcggaagaatcccggaaggtgtagaaaagctt
cgttcgttgtctttcatggcgttgagcaacaacaaactaaagggagcttttccaaaagga
atctcgaaccttcagagtttgcagtacttcataatggataataacccaatgttcgttgct
ctccccgttgaattagggtttcttcctaaacttcaagagctccagctcgagaattctgga
tattccggcgtaatcccggagagttacaccaaattgacgaaccttagctcgttgtctctt
gctaacaacagattaaccggcgaaatcccatcagggtttgagtctctgccacacgttttc
catctgaatctcagcaggaacttactgatcggcgttgttccgtttgattcaagtttctta
agacggttgggtaagaacttggatttgagcgggaacagaggattgtgtctgaatccggag
gatgagtttagtgttgtcaagaccggggttgatgtatgcgggaagaacgttagtagtggt
ggaggtttatcggtgcattcatcgaagaagaaatctcaagcttctcggtattacagatct
tgcttcttcgccaatgctctgtttccgtttgctctgtttctaggtttacatcaacgatgg
gttctctaa

DBGET integrated database retrieval system