KEGG   Arabidopsis thaliana (thale cress): AT2G43290Help
Entry
AT2G43290         CDS       T00041                                 

Gene name
MSS3
Definition
(RefSeq) Calcium-binding EF-hand family protein
  KO
K13448  
calcium-binding protein CML
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    AT2G43290 (MSS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
2
AA seq 215 aa AA seqDB search
MVRIFLLYNILNSFLLSLVPKKLRTLFPLSWFDKTLHKNSPPSPSTMLPSPSSSSAPTKR
IDPSELKRVFQMFDKNGDGRITKEELNDSLENLGIYIPDKDLTQMIHKIDANGDGCVDID
EFESLYSSIVDEHHNDGETEEEDMKDAFNVFDQDGDGFITVEELKSVMASLGLKQGKTLD
GCKKMIMQVDADGDGRVNYKEFLQMMKGGGFSSSN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggtgagaatattccttctctacaatatactaaattcgtttcttctctctttagtacca
aagaagctacgaactcttttccctctttcttggttcgacaaaactctccacaagaactca
ccaccgtctccgtcaacgatgttaccttctccatcatcttcttcagcgccgacgaaaaga
atagatccgtccgagctcaaacgcgttttccagatgttcgacaagaacggtgacggtcga
atcacaaaggaagagctcaacgactcgcttgagaatcttggaatctacataccagacaaa
gatctgactcaaatgatccacaagatcgatgctaacggtgatggatgcgtcgacatagac
gagtttgagtcgctgtacagctcgattgtggatgagcatcacaacgatggcgaaacagag
gaagaggatatgaaagatgcgtttaacgtgtttgaccaagacggagatgggtttatcact
gtggaggagttgaaatctgtgatggcttccttgggactcaagcaagggaagaccctagat
ggttgtaagaagatgattatgcaagttgatgcagatggtgatggtagagtcaattacaaa
gagtttcttcagatgatgaaaggtggtggctttagcagcagtaattga

DBGET integrated database retrieval system