KEGG   Arabidopsis thaliana (thale cress): AT2G43560Help
Entry
AT2G43560         CDS       T00041                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP16-3
  KO
K01802  
peptidylprolyl isomerase [EC:5.2.1.8]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AT2G43560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 223 aa AA seqDB search
MAASSPSLLLPLGSASRNGLTTKNPNSSRYIAARVIASETREQSCKISNLSSRREAMLLV
LGVSGGLSMSSLAAYAAGLPPEDKPRLCEAECEKELENVPMVTTESGLQYKDIKVGRGPS
PPVGFQVAANYVAMVPSGQIFDSSLEKGLPYLFRVGSGQVIKGLDEGILSMKAGGKRRLY
IPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEFIPGLDSEEE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttcttctccatctctccttctaccactaggttcagcatctagaaatggtcta
accaccaagaatccaaattcatcaagatatatagctgcaagagtcatagcttcagaaaca
agagagcaaagctgtaaaatcagtaatctctctagccgtagagaagcaatgcttttggta
ctcggcgtctcaggaggattatcaatgagctcacttgcggcgtatgcagctggtttacct
ccagaagataaaccaagactctgtgaagcagaatgcgagaaagagcttgaaaatgttcca
atggtaactacagagtcagggcttcagtataaggatattaaagttggtagaggcccgagt
ccaccggttggttttcaggttgctgctaattatgtggctatggttccatcagggcaaata
ttcgacagttctctggagaaaggtctaccgtatctatttcgcgttggctctggccaggtg
atcaaaggacttgatgaaggaatcttgagtatgaaagctggtggcaaacgtagactctac
atcccagggcctttggcgtttccaaagggtctagtttcagctccagggaggccgagagtt
gcgccaaacagcccggtgatatttgacgtgagcttagagttcataccaggtctcgattca
gaggaagagtga

DBGET integrated database retrieval system