KEGG   Arabidopsis thaliana (thale cress): AT2G43580Help
Entry
AT2G43580         CDS       T00041                                 

Definition
(RefSeq) Chitinase family protein
  KO
K01183  
chitinase [EC:3.2.1.14]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AT2G43580
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     AT2G43580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 265 aa AA seqDB search
MALTKIFLILLLSLLGLYSETVKSQNCDCAPNLCCSQFGYCGTTADYCGSTCQSGPCRVG
GPPTGAGLVGNIVTQIFFNNIINQAGNGCAGKSFYTRDSFINATNTFPSFANTVTRREIA
TMFAHFTYETGHFCYIEEINGASRVMCDQNNRQYPCAPAKSYHGRGPLLLSWNFNYGACG
QSLGLDLLRQPELVSSNPVVAFRTALWFWMKSVRPVLNQGFGATIRAISGFDCDGRNLGG
VNARIGYYRDYCGQLGLDPGANITC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggctctcacaaaaatcttcttaatccttctcctatccctcttaggtttatattctgaa
accgtcaaatctcaaaactgcgattgcgcccctaacctatgttgcagtcagttcggttat
tgcggtaccactgcagattactgtggttctacgtgccaatcaggtccttgtagagtcggt
ggaccccctaccggtgccggtttggttggtaatatcgtgacacaaattttctttaacaac
attatcaaccaagccggtaatggatgcgcgggaaaaagtttttacacccgggactctttc
attaacgccaccaatactttccccagctttgctaataccgttactagacgtgaaattgct
accatgtttgctcatttcacttacgagacaggacacttctgctacatagaagagataaac
ggggcgtcacgtgtcatgtgcgaccagaacaacaggcaatatccatgtgcaccggccaag
agctaccatggccgtggtccgctcctactatcatggaacttcaactatggagcatgcggc
cagagtctcggcttagacctcctacgccagcccgagctggtgagtagtaacccagtcgtg
gctttcaggacggctctgtggttttggatgaagagcgtgaggcctgtattgaaccaggga
tttggagccaccataagagccatcagcggtttcgactgtgacggtaggaacttaggtggg
gtgaacgcaaggattggctactatagagactattgtgggcagcttggtttggaccctggc
gccaacataacttgctaa

DBGET integrated database retrieval system