KEGG   Arabidopsis thaliana (thale cress): AT2G43790Help
Entry
AT2G43790         CDS       T00041                                 

Gene name
MPK6
Definition
MAP kinase 6
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant hormone signal transduction
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT2G43790 (MPK6)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    AT2G43790 (MPK6)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AT2G43790 (MPK6)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AT2G43790 (MPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 395 aa AA seqDB search
MDGGSGQPAADTEMTEAPGGFPAAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTA
KYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHE
NIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYI
HSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSD
YTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIR
QLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPEC
TIPFNFDFENHALSEEQMKELIYREALAFNPEYQQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggacggtggttcaggtcaaccggcggctgatacagagatgacagaagctcctggaggt
tttcccgcggcggctccatcgcctcagatgcctgggattgagaatattccggcgactctt
agccatggtggtaggtttattcagtataacatatttggaaacatcttcgaggtcaccgct
aagtataagcctccgatcatgcctattggcaagggtgcttatggcatcgtttgttcggct
atgaattctgaaactaacgagagcgttgcgattaagaaaattgctaacgcttttgacaat
aagattgatgctaagaggactctccgtgagatcaagctgcttcgtcacatggatcatgaa
aatattgttgcaatcagagatattatcccgccaccattaagaaacgctttcaacgatgtt
tacatcgcgtatgagttaatggacactgatctccatcaaatcattcggtcaaatcaagca
ttatccgaagaacattgccagtattttctttaccagatcctccgtggattgaaatacatt
cactctgcaaatgtgcttcacagggatttgaaaccaagtaatctcctcctgaacgcaaac
tgcgacctaaaaatctgcgattttgggctagctcgagtcacttctgagagtgatttcatg
actgaatatgttgtcacgagatggtaccgtgcaccagagcttctcttaaactcttctgat
tatactgcagctatcgatgtttggtctgtaggctgtattttcatggagttaatggaccgt
aagccactcttccctggacgagatcatgtccatcagcttcgcttgctcatggagctcata
ggaactccatcagaagaagagctcgagttcttgaacgaaaacgcaaagcgatacataaga
cagcttccaccttatcctcgccaatccatcactgataagttcccgacagtgcatccttta
gctatagaccttatcgagaagatgttaacatttgatcctagacggagaatcacagtttta
gacgcattggcccatccatacctgaactcgttgcacgacataagcgatgagccagagtgt
acaatacctttcaactttgattttgaaaaccatgcactctcagaggagcagatgaaggaa
ctaatctaccgcgaggcgcttgctttcaatccagaatatcagcaatag

DBGET integrated database retrieval system