KEGG   Arabidopsis thaliana (thale cress): AT2G44150Help
Entry
AT2G44150         CDS       T00041                                 

Gene name
ASHH3
Definition
histone-lysine N-methyltransferase ASHH3
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ath00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 363 aa AA seqDB search
MPASKKISDRNHLGQVFDKLLNQIGESEEFELPEWLNKGKPTPYIFIRRNIYLTKKVKRR
VEDDGIFCSCSSSSPGSSSTVCGSNCHCGMLFSSCSSSCKCGSECNNKPFQQRHVKKMKL
IQTEKCGSGIVAEEEIEAGEFIIEYVGEVIDDKTCEERLWKMKHRGETNFYLCEITRDMV
IDATHKGNKSRYINHSCNPNTQMQKWIIDGETRIGIFATRGIKKGEHLTYDYQFVQFGAD
QDCHCGAVGCRRKLGVKPSKPKIASDEAFNLVAHELAQTLPKVHQNGLVNRHIDAGKSWN
NLSQRDTCSRNCIGVVIRLSRPTSDRCFGLVRHFDEYSRKHSVMFEDGVTEFVDMSREDW
EIV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccagccagcaaaaagatttcggaccggaatcacttagggcaagtgttcgacaagcta
ttgaatcagattggagaatctgaagaattcgagttaccggagtggttgaataaaggaaaa
cctactccttatatcttcatcaggcgcaatatatacttgacgaagaaagtcaaaaggagg
gttgaagatgatggaatcttctgttcttgctcctcctcgtctcctggttcttcttcaact
gtctgtgggagtaattgccattgtgggatgctattctcaagctgttcctcaagttgcaag
tgtgggagtgagtgtaacaataagccgttccaacaacgacatgtcaagaagatgaagtta
attcagacagaaaaatgcggatcagggattgtggcagaagaagaaatcgaagctggagag
tttatcattgaatatgttggagaagttattgatgataagacttgtgaagagaggctttgg
aagatgaaacaccgtggcgagacaaacttttatttatgtgagataaccagagatatggtt
attgatgctactcataagggaaacaaatcaagatatattaatcatagctgcaaccctaat
acgcagatgcagaaatggataattgacggcgagaccagaatcggcattttcgccacccgt
ggtatcaaaaagggagagcatttgacctatgattatcagtttgttcagtttggtgcagat
caagactgccattgtggggctgtaggttgcagaaggaagcttggtgtaaaacctagcaaa
cctaagatagcctcggatgaagcttttaatctagtggcacatgaattggcccagacactg
cccaaggtgcatcaaaatggacttgtaaatagacacatagatgcaggaaaatcatggaac
aatcttagtcaaagggatacatgttcgcgtaattgcattggtgtggtgatcaggttatct
cgccccacgagtgataggtgttttggcctcgttagacattttgatgagtattcaagaaag
cactcggtgatgttcgaggatggtgttaccgagtttgtcgacatgtcgagagaagactgg
gagattgtctaa

DBGET integrated database retrieval system