KEGG   Arabidopsis thaliana (thale cress): AT2G44460Help
Entry
AT2G44460         CDS       T00041                                 

Gene name
BGLU28
Definition
(RefSeq) beta glucosidase 28
  KO
K01188  
beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Phenylpropanoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT2G44460 (BGLU28)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT2G44460 (BGLU28)
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT2G44460 (BGLU28)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT2G44460 (BGLU28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 582 aa AA seqDB search
MKMHFFILLVITSWLSEKITSLPPDSRVFDRHGFPDNFVFGTAASAFQYEGATSEGGKSP
SIWDYFSHTFPERTRMQNADVAVDFYHRYKDDIKLMKELNMDAFRFSISWARLIPSGKVK
DGVNKEGVEFYKALIDELVANGIEPSMTLYHWDHPQSLEDEYGGFLSPQIVEDFRDFSRV
CFEEFGDKVKMWTTINEPYVITVAGYDTGNKAVGRCSKWVNSKCQGGDSGTEPYIASHHL
LLAHAAAVQEFRKCNKTQDGQIGIVLSPLWFEPYDSASPADNEAVKRALATELDWHLDPV
IHGDYPEMMKKLAGNRLPSFTPEQSKMLKNSSDFIGINYYTARYVAHIPQADPARPRFVT
DHQLQWRVTNHSNHQFGPGEDRGILQSHPEGLRKVLNYIKDKYNNPIVYIKENGINDYDD
GTKSREEILNDTFRISYHEDHLQQLQKAIIEDGCDVRGYYVWSLLDNFEWEHGYSTRFGV
YYVDYDNDLTRIPKDSVNWFKQFLDVKNKEIWDVSHKERYNKTFDDVESFEASVGSILYL
MTNNISRREEEERDQCAFGNLNDQSGLLLESYNSFGFLENVW
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcattttttcatcctccttgtaataacctcatggttgtcggagaaaattact
tcacttcctcctgattctcgagtattcgatcgtcatggttttcccgataattttgttttt
ggaacagctgcatcagcttttcagtacgaaggtgcaacaagcgaaggtgggaaatctcca
tctatatgggattacttcagccacacttttccagaaagaaccagaatgcagaatgcagat
gtagcggtcgatttttaccatcgttataaggatgacatcaagttgatgaaagagctaaat
atggacgctttcagattttcgatttcgtgggctagattaatacccagtggaaaagtaaaa
gatggagtaaacaaagaaggtgtagaattctataaggctcttatcgacgagcttgttgct
aatggcattgaaccatcgatgaccctctaccattgggaccatcctcaatcactggaagac
gagtatggtggtttcttaagccctcaaatagtagaagattttcgagatttttcaagagtg
tgttttgaagaattcggagacaaagttaagatgtggactactataaacgagccttatgtc
ataactgttgcgggctacgacactggcaacaaagcggttggacgatgctcgaaatgggtg
aatagtaagtgtcaaggtggcgattcaggtactgagccttacattgcatcacatcacctt
cttctcgctcatgccgcagctgtacaagagttccgaaaatgtaacaagactcaagacggt
cagattgggatagtgttatctcctttgtggtttgagccttacgactctgcttctcctgcc
gacaacgaagctgttaaacgagctcttgccactgaactagattggcatttagatccagtt
attcacggagattatccagaaatgatgaagaaacttgccggaaatagattaccttcgttc
actccagaacaatccaaaatgttgaaaaattcatcggatttcattggaataaactactat
acagcgcgttacgttgctcatattccacaagccgatcctgctcgtccgcgattcgtaacc
gatcatcagctccaatggcgagtaacaaatcacagtaatcaccaattcggaccaggggaa
gatcgaggcatacttcaatcacatcctgaaggtttacgaaaagttcttaactacatcaaa
gataaatacaacaaccctatagtttatatcaaagagaacggaattaatgactacgacgac
ggtacaaaatcacgagaggagattctcaatgatacatttaggataagctaccatgaggac
catctccaacaactccaaaaagctataatagaggatgggtgtgacgtccgaggatattac
gtgtggtctttactagacaatttcgagtgggaacatggatattctactagatttggcgtg
tactatgttgactacgacaacgatctcactcgtattcccaaagattccgttaactggttc
aagcagttcctcgatgtaaagaataaagaaatatgggatgtgtcacataaagaaaggtat
aataagacttttgatgatgtagaaagtttcgaggcatctgttggttcgattctctatctc
atgacgaacaacatatcgaggagagaagaggaagaaagagatcaatgcgcttttgggaat
cttaatgatcagtccggtctgttgttggaatcatataattctttcggatttttagaaaac
gtttggtga

DBGET integrated database retrieval system