KEGG   Arabidopsis thaliana (thale cress): AT2G44610Help
Entry
AT2G44610         CDS       T00041                                 

Gene name
RAB6A
Definition
(RefSeq) Ras-related protein RABH1B
  KO
K07893  
Ras-related protein Rab-6A
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AT2G44610 (RAB6A)
  Exosomal proteins of bladder cancer cells
   AT2G44610 (RAB6A)
GTP-binding proteins [BR:ath04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    AT2G44610 (RAB6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 208 aa AA seqDB search
MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL
QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWIDEVRTERGSDVIVVLV
GNKTDLVDKRQVSIEEAEAKARELNVMFIETSAKAGFNIKALFRKIAAALPGMETLSSTK
QEDMVDVNLKSSNANASLAQQQSGGCSC
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggctccggtctcggcactcgctaagtataagctggtgtttctgggagatcaatccgtc
ggcaaaaccagtatcattactcgattcatgtacgacaaattcgacaacacttaccaggcc
acaattggtattgattttctatcaaagacaatgtaccttgaagatcgaacggtcagactt
cagttgtgggatacagctgggcaagagcgattcaggagtctaattccgagctatatcagg
gattcctccgttgctgttattgtgtatgatgttgcaagcaggcagtccttcctaaacact
actaagtggatcgatgaggttaggacagaacgtggtagtgatgtcatagtcgtgcttgtg
ggaaacaaaactgatctagtggacaaaaggcaagtgtcaatagaggaagcagaagctaag
gcacgcgaacttaatgtaatgttcatcgaaaccagtgccaaagcgggcttcaacattaag
gcgctcttccgcaagatagcagcagctttgccgggaatggagacattgtcttcaacaaag
caagaggatatggttgatgtcaatctcaagtcttccaatgcaaatgcatctctcgctcag
cagcaatcaggaggatgctcttgttag

DBGET integrated database retrieval system