KEGG   Arabidopsis thaliana (thale cress): AT2G44810Help
Entry
AT2G44810         CDS       T00041                                 

Gene name
DAD1
Definition
(RefSeq) alpha/beta-Hydrolases superfamily protein
  KO
K16818  phospholipase A1 [EC:3.1.1.32]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00564  Glycerophospholipid metabolism
ath00592  alpha-Linolenic acid metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT2G44810 (DAD1)
   00592 alpha-Linolenic acid metabolism
    AT2G44810 (DAD1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     AT2G44810 (DAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_3 DUF2974 DUF676 FSH1 PGAP1 Thioesterase Abhydrolase_6 Esterase Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 819090
NCBI-ProteinID: NP_001324613
MIPS: AT2G44810.1
TAIR: AT2G44810
Araport: AT2G44810
UniProt: Q948R1
Position
2
AA seq 447 aa AA seqDB search
MRFSLSPVRPHSVVVPSLPKQDVVSYISGTTSNRQCRCVLTLPSPSVSTSRPPVLPKPET
WESLLLNHDQIPGEFSPTGSSIPVKLGRRWMEYQGLQNWDGLLDPLDDNLRREILRYGQF
VESAYQAFDFDPSSPTYGTCRFPRSTLLERSGLPNSGYRLTKNLRATSGINLPRWIEKAP
SWMATQSSWIGYVAVCQDKEEISRLGRRDVVISFRGTATCLEWLENLRATLTHLPNGPTG
ANLNGSNSGPMVESGFLSLYTSGVHSLRDMVREEIARLLQSYGDEPLSVTITGHSLGAAI
ATLAAYDIKTTFKRAPMVTVISFGGPRVGNRCFRKLLEKQGTKVLRIVNSDDVITKVPGV
VLENREQDNVKMTASIMPSWIQRRVEETPWVYAEIGKELRLSSRDSPHLSSINVATCHEL
KTYLHLVDGFVSSTCPFRETARRVLHR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagattctctctttctcccgtacgtccgcatagtgtagtagtaccttcactaccaaaa
caggacgtcgtttcttatataagtggtacgacgtcgaatcgtcaatgtcgatgtgtactt
acacttccttctccttcagtttccacttcccgaccaccggttttacccaaaccggaaacc
tgggagagtttgctgctaaaccatgatcaaattccaggcgaattctcacccactggttcg
agtatcccggttaagcttggccggagatggatggagtatcaggggcttcaaaattgggac
ggtcttttagacccattggacgacaatctccggcgagagattctccggtacggtcaattt
gtcgaatcggcttatcaagcatttgatttcgatccttcctctccaacctacgggacatgc
cggtttccgaggagcacgttgttagagcgatccggtttacccaactccggttatcgacta
acgaagaaccttcgtgccacgtcaggtattaacttgccacgttggattgagaaagcgcca
agctggatggctacacaatctagctggattggttacgtggcagtttgccaggacaaagaa
gagatctcgcggcttgggcgtagagacgtcgtcatctccttccgtggaaccgccacgtgt
ctcgagtggttagagaaccttcgcgccacgctgactcatctccctaatgggcctactgga
gcaaatctaaacgggtctaactctgggcccatggttgagagcgggtttttaagcttgtat
acttcaggtgttcacagtttgagagacatggtaagagaagagatcgcaaggctactccaa
tcttacggcgacgagccgttaagtgtaacgataaccggtcacagcctcggcgctgcgatc
gcgacactagcagcttacgatatcaaaacgacgtttaaacgtgcgcctatggttaccgta
atatctttcggaggtccacgtgtcggaaacagatgctttcggaaactccttgagaagcaa
ggcacgaaggttctaagaatcgtgaactccgacgacgtcatcaccaaagttcctggagtt
gttttagaaaacagagagcaagataacgttaagatgacagcgtcgataatgccgagctgg
atacagagacgcgtggaggagacgccgtgggtttacgctgaaatcggtaaggagcttcgg
ctgagtagccgtgactcgccgcacttgagcagcatcaatgtggccacgtgtcatgagctg
aaaacgtatttacatttggtagacgggtttgtgagctccacgtgtccattcagagaaaca
gctcggagagttctccatagatga

DBGET integrated database retrieval system