KEGG   Arabidopsis thaliana (thale cress): AT2G44810Help
Entry
AT2G44810         CDS       T00041                                 

Gene name
DAD1
Definition
phospholipase A(1) DAD1
Orthology
K16818  
phospholipase A1 [EC:3.1.1.32]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerophospholipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ath00564]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ath00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 357 aa AA seqDB search
MEYQGLQNWDGLLDPLDDNLRREILRYGQFVESAYQAFDFDPSSPTYGTCRFPRSTLLER
SGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKEEISRLGRRDV
VISFRGTATCLEWLENLRATLTHLPNGPTGANLNGSNSGPMVESGFLSLYTSGVHSLRDM
VREEIARLLQSYGDEPLSVTITGHSLGAAIATLAAYDIKTTFKRAPMVTVISFGGPRVGN
RCFRKLLEKQGTKVLRIVNSDDVITKVPGVVLENREQDNVKMTASIMPSWIQRRVEETPW
VYAEIGKELRLSSRDSPHLSSINVATCHELKTYLHLVDGFVSSTCPFRETARRVLHR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagtatcaggggcttcaaaattgggacggtcttttagacccattggacgacaatctc
cggcgagagattctccggtacggtcaatttgtcgaatcggcttatcaagcatttgatttc
gatccttcctctccaacctacgggacatgccggtttccgaggagcacgttgttagagcga
tccggtttacccaactccggttatcgactaacgaagaaccttcgtgccacgtcaggtatt
aacttgccacgttggattgagaaagcgccaagctggatggctacacaatctagctggatt
ggttacgtggcagtttgccaggacaaagaagagatctcgcggcttgggcgtagagacgtc
gtcatctccttccgtggaaccgccacgtgtctcgagtggttagagaaccttcgcgccacg
ctgactcatctccctaatgggcctactggagcaaatctaaacgggtctaactctgggccc
atggttgagagcgggtttttaagcttgtatacttcaggtgttcacagtttgagagacatg
gtaagagaagagatcgcaaggctactccaatcttacggcgacgagccgttaagtgtaacg
ataaccggtcacagcctcggcgctgcgatcgcgacactagcagcttacgatatcaaaacg
acgtttaaacgtgcgcctatggttaccgtaatatctttcggaggtccacgtgtcggaaac
agatgctttcggaaactccttgagaagcaaggcacgaaggttctaagaatcgtgaactcc
gacgacgtcatcaccaaagttcctggagttgttttagaaaacagagagcaagataacgtt
aagatgacagcgtcgataatgccgagctggatacagagacgcgtggaggagacgccgtgg
gtttacgctgaaatcggtaaggagcttcggctgagtagccgtgactcgccgcacttgagc
agcatcaatgtggccacgtgtcatgagctgaaaacgtatttacatttggtagacgggttt
gtgagctccacgtgtccattcagagaaacagctcggagagttctccatagatga

DBGET integrated database retrieval system