KEGG   Arabidopsis thaliana (thale cress): AT2G44810Help
Entry
AT2G44810         CDS       T00041                                 

Gene name
DAD1
Definition
(RefSeq) phospholipase A(1) DAD1
  KO
K16818  
phospholipase A1 [EC:3.1.1.32]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerophospholipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT2G44810 (DAD1)
   00592 alpha-Linolenic acid metabolism
    AT2G44810 (DAD1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     AT2G44810 (DAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 357 aa AA seqDB search
MEYQGLQNWDGLLDPLDDNLRREILRYGQFVESAYQAFDFDPSSPTYGTCRFPRSTLLER
SGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKEEISRLGRRDV
VISFRGTATCLEWLENLRATLTHLPNGPTGANLNGSNSGPMVESGFLSLYTSGVHSLRDM
VREEIARLLQSYGDEPLSVTITGHSLGAAIATLAAYDIKTTFKRAPMVTVISFGGPRVGN
RCFRKLLEKQGTKVLRIVNSDDVITKVPGVVLENREQDNVKMTASIMPSWIQRRVEETPW
VYAEIGKELRLSSRDSPHLSSINVATCHELKTYLHLVDGFVSSTCPFRETARRVLHR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagtatcaggggcttcaaaattgggacggtcttttagacccattggacgacaatctc
cggcgagagattctccggtacggtcaatttgtcgaatcggcttatcaagcatttgatttc
gatccttcctctccaacctacgggacatgccggtttccgaggagcacgttgttagagcga
tccggtttacccaactccggttatcgactaacgaagaaccttcgtgccacgtcaggtatt
aacttgccacgttggattgagaaagcgccaagctggatggctacacaatctagctggatt
ggttacgtggcagtttgccaggacaaagaagagatctcgcggcttgggcgtagagacgtc
gtcatctccttccgtggaaccgccacgtgtctcgagtggttagagaaccttcgcgccacg
ctgactcatctccctaatgggcctactggagcaaatctaaacgggtctaactctgggccc
atggttgagagcgggtttttaagcttgtatacttcaggtgttcacagtttgagagacatg
gtaagagaagagatcgcaaggctactccaatcttacggcgacgagccgttaagtgtaacg
ataaccggtcacagcctcggcgctgcgatcgcgacactagcagcttacgatatcaaaacg
acgtttaaacgtgcgcctatggttaccgtaatatctttcggaggtccacgtgtcggaaac
agatgctttcggaaactccttgagaagcaaggcacgaaggttctaagaatcgtgaactcc
gacgacgtcatcaccaaagttcctggagttgttttagaaaacagagagcaagataacgtt
aagatgacagcgtcgataatgccgagctggatacagagacgcgtggaggagacgccgtgg
gtttacgctgaaatcggtaaggagcttcggctgagtagccgtgactcgccgcacttgagc
agcatcaatgtggccacgtgtcatgagctgaaaacgtatttacatttggtagacgggttt
gtgagctccacgtgtccattcagagaaacagctcggagagttctccatagatga

DBGET integrated database retrieval system