KEGG   Arabidopsis thaliana (thale cress): AT2G45670Help
Entry
AT2G45670         CDS       T00041                                 

Definition
calcineurin B subunit-related protein
Orthology
K13510  
lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT2G45670
   00565 Ether lipid metabolism
    AT2G45670
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     AT2G45670
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     AT2G45670
Lipid biosynthesis proteins [BR:ath01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   AT2G45670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 539 aa AA seqDB search
MADPDLSSPLIHHQSSDQPEVVISIADDDDDESGLNLLPAVVDPRVSRGFEFDHLNPYGF
LSESEPPVLGPTTVDPFRNNTPGVSGLYEAIKLVICLPIALIRLVLFAASLAVGYLATKL
ALAGWKDKENPMPLWRCRIMWITRICTRCILFSFGYQWIRRKGKPARREIAPIVVSNHVS
YIEPIFYFYELSPTIVASESHDSLPFVGTIIRAMQVIYVNRFSQTSRKNAVHEIKRKASC
DRFPRLLLFPEGTTTNGKVLISFQLGAFIPGYPIQPVVVRYPHVHFDQSWGNISLLTLMF
RMFTQFHNFMEVEYLPVIYPSEKQKQNAVRLSQKTSHAIATSLNVVQTSHSFADLMLLNK
ATELKLENPSNYMVEMARVESLFHVSSLEATRFLDTFVSMIPDSSGRVRLHDFLRGLKLK
PCPLSKRIFEFIDVEKVGSITFKQFLFASGHVLTQPLFKQTCELAFSHCDADGDGYITIQ
ELGEALKNTIPNLNKDEIRGMYHLLDDDQDQRISQNDLLSCLRRNPLLIAIFAPDLAPT
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcctgatctgtcttctcctttgatccaccatcaatcctccgatcaacctgaa
gttgttatctctatcgccgacgacgacgacgacgagtcaggactcaatcttcttccagcc
gttgttgaccctcgtgtttcacgaggttttgagtttgaccatcttaatccttatggcttt
ctcagcgagtcagagcctccggttctcggtccgacgacggtggatccattccggaacaat
acacctggagttagcggattgtacgaagcgattaagctcgtgatttgtcttccgattgct
ctgattagacttgttctctttgctgctagcttagctgttggttacttggctacaaaattg
gcacttgctggctggaaagataaagagaaccctatgcctctttggagatgcagaatcatg
tggattactcggatctgtaccagatgtatcctcttctcttttggctatcagtggataaga
aggaaagggaaacctgctcggagagagattgctccgattgttgtatcaaatcatgtttct
tatattgaaccaatcttctacttctatgaattatcaccgaccattgttgcatcggagtca
catgattcacttccatttgttggaactattatcagggcaatgcaggtgatatatgtgaat
agattctcacagacatcaaggaagaatgctgtgcatgaaataaagagaaaagcttcctgc
gatagatttcctcgtctgctgttattccccgaaggaaccacgactaatgggaaagttctt
atttccttccaactcggtgctttcatccctggttaccctattcaacctgtagtagtccgg
tatccccatgtacattttgatcaatcctggggaaatatctctttgttgacgctcatgttt
agaatgttcactcagtttcacaatttcatggaggttgaatatcttcctgtaatctatccc
agtgaaaagcaaaagcagaatgctgtgcgtctctcacagaagactagtcatgcaattgca
acatctttgaatgtcgtccaaacatcccattcttttgcggacttgatgctactcaacaaa
gcaactgagttaaagctggagaacccctcaaattacatggttgaaatggcaagagttgag
tcgctattccatgtaagcagcttagaggcaacgcgatttttggatacatttgtttccatg
attccggactcgagtggacgtgttaggctacatgactttcttcggggtcttaaactgaaa
ccttgccctctttctaaaaggatatttgagttcatcgatgtggagaaggtcggatcaatc
actttcaaacagttcttgtttgcctcgggccacgtgttgacacagccgctttttaagcaa
acatgcgagctagccttttcccattgcgatgcagatggagatggctatattacaattcaa
gaactcggagaagctctcaaaaacacaatcccaaacttgaacaaggacgagattcgagga
atgtaccatttgctagacgacgaccaagatcaaagaatcagccaaaatgacttgttgtcc
tgcttaagaagaaaccctcttctcatagccatctttgcacctgacttggccccaacataa

DBGET integrated database retrieval system