KEGG   Arabidopsis thaliana (thale cress): AT2G46050Help
Entry
AT2G46050         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR-like) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 PPR_1 PPR_3 AEP1
Motif
Other DBs
NCBI-GeneID: 819213
NCBI-ProteinID: NP_182129
MIPS: AT2G46050.1
TAIR: AT2G46050
Araport: AT2G46050
UniProt: O82363
Position
2
AA seq 590 aa AA seqDB search
MRFTFLRSTRIFLANHQNHLSSLQNIRTIPSSSSSPVAISSVSKLSASLDHLSDVKQEHG
FMVKQGIYNSLFLQNKLLQAYTKIREFDDADKLFDEMPLRNIVTWNILIHGVIQRDGDTN
HRAHLGFCYLSRILFTDVSLDHVSFMGLIRLCTDSTNMKAGIQLHCLMVKQGLESSCFPS
TSLVHFYGKCGLIVEARRVFEAVLDRDLVLWNALVSSYVLNGMIDEAFGLLKLMGSDKNR
FRGDYFTFSSLLSACRIEQGKQIHAILFKVSYQFDIPVATALLNMYAKSNHLSDARECFE
SMVVRNVVSWNAMIVGFAQNGEGREAMRLFGQMLLENLQPDELTFASVLSSCAKFSAIWE
IKQVQAMVTKKGSADFLSVANSLISSYSRNGNLSEALLCFHSIREPDLVSWTSVIGALAS
HGFAEESLQMFESMLQKLQPDKITFLEVLSACSHGGLVQEGLRCFKRMTEFYKIEAEDEH
YTCLIDLLGRAGFIDEASDVLNSMPTEPSTHALAAFTGGCNIHEKRESMKWGAKKLLEIE
PTKPVNYSILSNAYVSEGHWNQAALLRKRERRNCYNPKTPGCSWLGDYSI
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttacattcctccgatcaactcggatcttccttgcgaaccatcagaaccactta
tcatccttgcaaaacattagaaccattccttcttcttcttcttcacctgtagctatatcc
tctgtatcgaagttatctgctagcttggatcatctctctgacgtgaaacaagaacatggt
ttcatggtaaaacaagggatttacaattctctgtttcttcaaaacaagctcttgcaagct
tacacgaaaatcagagaattcgatgatgcagataagctcttcgacgaaatgcctttgaga
aatattgttacttggaacatactgattcacggggtcattcaacgagacggtgacaccaac
cacagagctcatctaggtttttgttatttgagtcggattcttttcactgatgtgagtttg
gatcatgtgtcgttcatggggttgatacggttgtgtactgattcgaccaatatgaaagct
ggtatccaattacactgtctgatggtgaaacaaggtcttgaatcgagttgctttccgagt
actagtctagttcatttctatgggaaatgtggtctcattgtagaagcaagacgagttttt
gaggcggttttggatagagatttagtgctatggaacgctttagtttcgtcgtatgttctt
aacggtatgattgatgaagcttttggtttactcaagctgatgggttctgacaaaaacaga
ttcaggggtgattattttactttctcgagtcttctcagtgcatgcaggatcgaacaaggg
aagcagattcacgccattctcttcaaagtgtcatatcaattcgacattccggtggcgact
gcattgctgaatatgtatgctaagagtaaccatttgagtgatgctcgggagtgttttgaa
tcgatggttgtgagaaatgtagtgtcttggaatgcgatgattgtaggttttgcacaaaat
ggagaaggaagagaagctatgagactttttggtcaaatgctccttgagaatcttcaacca
gatgagcttacctttgcaagtgttctaagttcctgcgccaaattttctgcaatttgggag
attaagcaagtgcaagcgatggttactaaaaagggctcagcagattttttgtcggtcgct
aattctctgataagttcctactccaggaatggaaatttatctgaagcacttttatgtttt
cattcgatccgagaacctgatcttgtttcatggacttcagtgataggagctttggcttct
catggattcgcagaagaaagcttgcaaatgtttgaaagtatgctgcagaaacttcaacca
gacaagatcacttttttagaggttctgtctgcttgtagccatggaggattagttcaagaa
gggctccgttgcttcaaacgaatgactgagttttacaagatagaagcagaggatgaacac
tacacgtgtctgatcgatcttcttggtcgagcaggtttcatcgacgaggcttctgatgtt
ttaaattcaatgcccacagaaccaagcacacatgctttggcagctttcacaggaggatgt
aacatccatgagaaaagagaatccatgaaatggggtgcaaagaagcttcttgaaattgaa
cctaccaaacctgtgaactactccatcctgtcaaacgcttatgtctctgaaggccattgg
aatcaagcggctctactgcgtaaaagagagaggagaaactgctacaatcccaaaactcca
ggttgcagttggctaggggactactcaatctag

DBGET integrated database retrieval system