KEGG   Arabidopsis thaliana (thale cress): AT2G46070Help
Entry
AT2G46070         CDS       T00041                                 

Gene name
MPK12
Definition
mitogen-activated protein kinase 12
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 324 aa AA seqDB search
MSGESSSGSTEHCIKVVPTHGGRYVQYNVYGQLFEVSRKYVPPIRPIGRGACGIVCAAVN
SVTGEKVAIKKIGNAFDNIIDAKRTLREIKLLRHMDHENVITIKDIVRPPQRDIFNDVYI
VYELMDTDLQRILRSNQTLTSDQCRFLVYQLLRGLKYVHSANILHRDLRPSNVLLNSKNE
LKIGDFGLARTTSDTDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTGQP
LFPGKDYVHQLRLITELVGSPDNSSLGFLRSDNARRYVRQLPRYPKQQFAARFPKMPTTA
IDLLERMLVFDPNRRISDLHVLCV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagaatcaagctctggttctaccgaacattgcatcaaagttgtaccgacacac
ggtggccgctatgttcagtacaacgtttatggacaactctttgaagtttccagaaagtat
gtccctcctattcgtcccattggtagaggcgcttgcggtattgtctgtgctgcggtgaac
tcagtgactggagagaaagtggctattaagaagatcggtaatgcttttgataacatcatc
gatgctaagagaacgctacgtgaaattaaacttctcaggcatatggatcatgagaacgtt
ataaccatcaaagatattgtaagacctccgcaacgagatatcttcaatgatgtctacatt
gtctatgagttaatggacactgatcttcagcgaatcctccgttctaaccaaacactgacc
agtgatcaatgccgtttcctagtataccagctcttaagagggctcaaatacgtgcactcg
gccaacatattacatcgtgatctaaggccaagcaacgtgctacttaactcgaaaaacgag
ctaaagattggtgattttgggcttgcaagaacaacttccgacacagacttcatgactgaa
tatgtcgttacccgttggtacagggctcctgagttgcttcttaactgctcagagtacacc
gcagctattgatatttggtctgttggctgcatactcggcgaaatcatgacgggacaaccg
ttgtttccaggcaaagattatgttcatcagcttaggcttataacagagcttgtaggctct
ccagacaattccagcctcggcttccttcgcagtgacaacgcaagaagatacgtcaggcaa
cttccgcgatacccgaaacaacagtttgctgctagattcccgaaaatgcccactacggct
atcgatttgcttgagagaatgctcgtctttgatcctaaccggcgcatctcagacctgcat
gtgttgtgtgtgtag

DBGET integrated database retrieval system