KEGG   Arabidopsis thaliana (thale cress): AT2G46070Help
Entry
AT2G46070         CDS       T00041                                 

Gene name
MPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AT2G46070 (MPK12)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   AT2G46070 (MPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 819215
NCBI-ProteinID: NP_182131
MIPS: AT2G46070.1
TAIR: AT2G46070
Araport: AT2G46070
UniProt: Q8GYQ5
Position
2
AA seq 372 aa AA seqDB search
MSGESSSGSTEHCIKVVPTHGGRYVQYNVYGQLFEVSRKYVPPIRPIGRGACGIVCAAVN
SVTGEKVAIKKIGNAFDNIIDAKRTLREIKLLRHMDHENVITIKDIVRPPQRDIFNDVYI
VYELMDTDLQRILRSNQTLTSDQCRFLVYQLLRGLKYVHSANILHRDLRPSNVLLNSKNE
LKIGDFGLARTTSDTDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTGQP
LFPGKDYVHQLRLITELVGSPDNSSLGFLRSDNARRYVRQLPRYPKQQFAARFPKMPTTA
IDLLERMLVFDPNRRISVDEALGHAYLSPHHDVAKEPVCSTPFSFDFEHPSCTEEHIKEL
IYKESVKFNPDH
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagaatcaagctctggttctaccgaacattgcatcaaagttgtaccgacacac
ggtggccgctatgttcagtacaacgtttatggacaactctttgaagtttccagaaagtat
gtccctcctattcgtcccattggtagaggcgcttgcggtattgtctgtgctgcggtgaac
tcagtgactggagagaaagtggctattaagaagatcggtaatgcttttgataacatcatc
gatgctaagagaacgctacgtgaaattaaacttctcaggcatatggatcatgagaacgtt
ataaccatcaaagatattgtaagacctccgcaacgagatatcttcaatgatgtctacatt
gtctatgagttaatggacactgatcttcagcgaatcctccgttctaaccaaacactgacc
agtgatcaatgccgtttcctagtataccagctcttaagagggctcaaatacgtgcactcg
gccaacatattacatcgtgatctaaggccaagcaacgtgctacttaactcgaaaaacgag
ctaaagattggtgattttgggcttgcaagaacaacttccgacacagacttcatgactgaa
tatgtcgttacccgttggtacagggctcctgagttgcttcttaactgctcagagtacacc
gcagctattgatatttggtctgttggctgcatactcggcgaaatcatgacgggacaaccg
ttgtttccaggcaaagattatgttcatcagcttaggcttataacagagcttgtaggctct
ccagacaattccagcctcggcttccttcgcagtgacaacgcaagaagatacgtcaggcaa
cttccgcgatacccgaaacaacagtttgctgctagattcccgaaaatgcccactacggct
atcgatttgcttgagagaatgctcgtctttgatcctaaccggcgcatctcagtcgatgaa
gcccttggccatgcttacctatcaccgcaccatgatgtggccaaagaaccggtctgttcg
actcctttcagctttgatttcgaacatccttcttgcacagaagaacacataaaggagctt
atctacaaggagtctgtcaaattcaatcctgaccactga

DBGET integrated database retrieval system