KEGG   Arabidopsis thaliana (thale cress): AT2G47000Help
Entry
AT2G47000         CDS       T00041                                 

Gene name
ABCB4
Definition
(RefSeq) ATP binding cassette subfamily B4
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:3.6.3.44]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AT2G47000 (ABCB4)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.44  xenobiotic-transporting ATPase
     AT2G47000 (ABCB4)
Transporters [BR:ath02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    AT2G47000 (ABCB4)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT2G47000 (ABCB4)
CD molecules [BR:ath04090]
 Proteins
  AT2G47000 (ABCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 AAA_22 AAA_16 RsgA_GTPase Zeta_toxin G-alpha DEAD DUF87 ABC_ATPase AAA_30 AAA_21 DUF815 AAA_15 AAA_24 AAA_25 SbcCD_C DLIC
Motif
Other DBs
NCBI-GeneID: 819314
NCBI-ProteinID: NP_001323914
MIPS: AT2G47000.1
TAIR: AT2G47000
Araport: AT2G47000
UniProt: O80725 A0A178VT74
Position
2
AA seq 1286 aa AA seqDB search
MASESGLNGDPNILEEVSETKRDKEEEEEVKKTEKKDEEHEKTKTVPFYKLFAFADSFDF
LLMILGTLGSIGNGLGFPLMTLLFGDLIDAFGENQTNTTDKVSKVALKFVWLGIGTFAAA
FLQLSGWMISGERQAARIRSLYLKTILRQDIAFFDIDTNTGEVVGRMSGDTVLIQDAMGE
KVGKAIQLLATFVGGFVIAFVRGWLLTLVMLSSIPLLVMAGALLAIVIAKTASRGQTAYA
KAATVVEQTIGSIRTVASFTGEKQAISNYNKHLVTAYKAGVIEGGSTGLGLGTLFLVVFC
SYALAVWYGGKLILDKGYTGGQVLNIIIAVLTGSMSLGQTSPCLSAFAAGQAAAYKMFET
IERRPNIDSYSTNGKVLDDIKGDIELKDVYFTYPARPDEQIFRGFSLFISSGTTVALVGQ
SGSGKSTVVSLIERFYDPQAGDVLIDGINLKEFQLKWIRSKIGLVSQEPVLFTASIKDNI
AYGKEDATTEEIKAAAELANASKFVDKLPQGLDTMVGEHGTQLSGGQKQRIAVARAILKD
PRILLLDEATSALDAESERVVQEALDRIMVNRTTVVVAHRLSTVRNADMIAVIHQGKIVE
KGSHTELLKDPEGAYSQLIRLQEEKKSDENAAEEQKMSSIESFKQSSLRKSSLGRSLSKG
GSSRGNSSRHSFNMFGFPAGIDGNVVQDQEEDDTTQPKTEPKKVSIFRIAALNKPEIPVL
ILGSISAAANGVILPIFGILISSVIKAFFQPPKKLKEDTSFWAIIFMVLGFASIIAYPAQ
TFFFAIAGCKLVQRIRSMCFEKVVHMEVGWFDEPENSSGTIGARLSADAATIRGLVGDSL
AQTVQNLSSILAGLIIAFLACWQLAFVVLAMLPLIALNGFLYMKFMKGFSADAKKMYGEA
SQVANDAVGSIRTVASFCAEDKVMNMYSKKCEGPMKNGIRQGIVSGIGFGFSFFVLFSSY
AASFYVGARLVDDGKTTFDSVFRVFFALTMAAMAISQSSSLSPDSSKADVAAASIFAIMD
RESKIDPSVESGRVLDNVKGDIELRHVSFKYPARPDVQIFQDLCLSIRAGKTVALVGESG
SGKSTVIALLQRFYDPDSGEITLDGVEIKSLRLKWLRQQTGLVSQEPILFNETIRANIAY
GKGGDASESEIVSSAELSNAHGFISGLQQGYDTMVGERGIQLSGGQKQRVAIARAIVKDP
KVLLLDEATSALDAESERVVQDALDRVMVNRTTIVVAHRLSTIKNADVIAVVKNGVIVEK
GKHDTLINIKDGVYASLVQLHLTAAS
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagagagcggcttaaatggagatccaaatatactagaagaggtttctgagacc
aaaagagacaaggaagaagaagaagaagtgaagaaaacagagaagaaagacgaggaacat
gagaaaaccaaaacggtgccgttttataagctctttgcttttgcagattcctttgatttc
ctcttgatgatcctcgggacgcttggatctattggaaatggtcttggcttccctcttatg
accttactgttcggagatctcattgatgcttttggagagaatcagactaatacaacagac
aaagtctccaaagttgctctgaagtttgtatggcttggaatcggtactttcgcagctgct
tttctccaattgtctggctggatgatttctggagagagacaagcagcgagaataaggagt
ttgtatctaaagacaatcttaagacaagatatagcctttttcgacatcgatacaaataca
ggagaagttgttggaagaatgtccggtgacactgtgctaatccaagatgccatgggagaa
aaggtgggaaaagctatacaacttctagcaacatttgtaggaggctttgtgatagctttc
gtaagaggatggcttctaacgttggtcatgttatcttcaattcctctacttgtaatggct
ggtgcacttctggctatcgtcattgctaaaacagcttctcgtggacaaactgcttacgcc
aaagctgccactgtagttgagcaaacaattggttctataagaacggttgcatcatttaca
ggagagaaacaagcgataagcaattacaataaacatcttgtcactgcttataaagcagga
gtcattgaaggtggttcaactggattgggtcttggaacgctctttcttgtagtcttttgt
agctacgctttagcagtatggtatggaggaaagttgatattggataaaggctacacagga
ggacaagttctcaatatcatcatcgctgttttaactggatccatgtcgttaggtcaaaca
tcgccttgcttaagcgcatttgcagctggacaagccgcggcttacaagatgtttgagaca
attgagagaagacctaacatagattcttatagtacaaatggtaaagttttggatgacatt
aagggagatattgagctcaaagatgtttactttacttacccagcgagacccgatgagcaa
atatttcgcggattctctctgtttatctcgagtggtacaacggtggctttagttggacaa
agtgggagcgggaaatctactgttgtgagtctgattgagaggttttacgatccacaagct
ggtgacgttctcatagatggtattaacttaaaagagtttcagctaaaatggattagaagc
aagattggacttgtgagtcaagaaccagttttgttcactgcaagcatcaaggataacatt
gcgtacggcaaagaagacgcaacaaccgaagagattaaagcagctgcagagctagcaaac
gcatctaaatttgtggataagctaccacagggtttggatacaatggttggagaacatggt
actcagctttccggtggacaaaaacagagaatcgcggtggctagagcaatcttaaaagat
ccaagaatcttacttttagatgaagctacaagcgcgcttgatgcagaatctgagagagtg
gttcaagaagcgcttgatagaattatggttaaccggactactgttgtggtcgctcatcgg
ttaagcactgtgcgaaatgcggatatgatcgctgtgatccaccaaggcaagatcgtcgag
aaaggttctcacacggaactactaaaggacccggaaggagcttattctcagctgattcgt
ctacaagaagagaagaaatctgatgagaatgcagcggaggagcaaaagatgtcatcaatt
gaatcattcaaacaatctagtctgagaaaatcgtctctaggccggtctctaagcaaagga
ggatcatccagaggaaacagcagccgccattctttcaatatgtttggttttccagcagga
attgacggaaacgtcgttcaagatcaagaagaggatgatactacacaaccaaaaaccgaa
ccaaaaaaagtctccattttcagaattgctgctctaaacaaaccagagattccggtgcta
atacttggatcaatatccgcagcagcaaatggcgttatccttccaatctttggcatacta
atctccagcgtaatcaaagcgtttttccaaccacctaaaaagctaaaagaagatacaagc
ttctgggcaatcatattcatggttcttggtttcgcatccatcattgcatacccagcacaa
accttcttctttgccatagctggatgtaaactagtgcagaggatcagaagtatgtgtttt
gagaaagtggttcacatggaagttggatggttcgacgagccagagaattctagtggaacc
ataggagcaaggctatcagcagatgctgccacaatccgtggtctagttggagactctttg
gctcagacagttcagaatctttcatctatattggctggtttgatcattgcatttttggct
tgttggcaattagctttcgtggtcctcgcgatgctcccgcttatcgcactcaatggattt
ctttatatgaagttcatgaaaggtttcagcgctgatgcaaagaaaatgtacggggaagca
agccaagtagcgaatgacgcggtagggagcataagaaccgttgcttcattctgtgcagaa
gacaaggtgatgaacatgtactcaaagaaatgtgaaggtccaatgaagaatgggattcgt
caaggcatagtcagtggtattggtttcggcttctctttcttcgtcctcttctcttcttac
gctgccagtttctacgttggagcacgccttgtcgatgatggcaaaacaaccttcgactct
gttttcagggttttctttgctttgacaatggcggcaatggcgatatctcaatcgagttcg
ttatctccagattccagcaaagccgatgtagctgctgcctcgattttcgcaataatggac
agggaatcaaagattgacccaagtgtggaatcaggaagagtgttggataatgttaaagga
gacattgagcttcgtcatgttagtttcaaatacccagcaagaccagatgttcaaatcttc
caagacctctgtctaagcattcgagctggaaagacagttgctttggttggagaaagcggt
agcgggaaatcaacggtgattgcattgttgcagaggttttacgatccagattcaggtgag
atcactcttgacggtgtagagatcaagagcctaagactaaaatggctaagacaacaaacg
ggacttgtgagccaagaaccaatcttgttcaacgagacaattagagccaacattgcttat
ggcaaaggaggagacgcgagtgaatccgaaatcgtatcttcagctgaattatcaaacgcc
catggattcatcagtggtctgcaacagggttatgatacgatggtgggagaaagaggaatt
caattatcaggcggacaaaagcaacgagtagctatagccagagccatcgtcaaagatcca
aaggtgttgctgctcgacgaagccacgagtgctcttgacgctgagtctgagcgtgtggtt
caggacgcgctagaccgtgttatggtaaaccggactacgattgtggtagctcaccggtta
tcgacgattaagaatgctgacgtaattgccgtcgttaagaacggcgtcatcgttgagaaa
ggaaagcacgacacgttgatcaatatcaaagacggagtttatgcttcgttagttcagctt
catctaaccgcggcttcttga

DBGET integrated database retrieval system