KEGG   Arabidopsis thaliana (thale cress): AT2G47400Help
Entry
AT2G47400         CDS       T00041                                 

Gene name
CP12-1
Definition
(RefSeq) stroma protein CP12-1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 124 aa AA seqDB search
MTTIAAAGLNVATPRVVVRPVARVLGPVRLNYPWKFGSMKRMVVVKATSEGEISEKVEKS
IQEAKETCADDPVSGECVAAWDEVEELSAAASHARDKKKAGGSDPLEEYCNDNPETDECR
TYDN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccatagctgcagctggcctcaacgtcgcgactccacgagtggtcgttcgacct
gtggctcgtgtattaggtccggtccggttgaattacccgtggaaattcggttcgatgaag
cggatggttgtggttaaggctacatcggaaggagagatatcggagaaggtggagaagagt
atacaagaagctaaggagacatgcgctgatgatccggtgagcggggagtgtgtagcggct
tgggacgaggtggaggagctgagtgcggcggcgagtcatgctagggacaagaagaaagct
ggtggctccgatcctttggaagagtattgcaatgataatcctgagactgatgagtgtcgt
acttatgataattaa

DBGET integrated database retrieval system