KEGG   Arabidopsis thaliana (thale cress): AT2G47430Help
Entry
AT2G47430         CDS       T00041                                 

Gene name
CKI1
Definition
(RefSeq) histidine kinase CKI1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
2
AA seq 1122 aa AA seqDB search
MMVKVTKLVASRPIVVFCVLAFLVVVFECIWISNWRTTTENLVKEVASFTEDLRTSLVSE
IENIGKFTYAKTNLSTIGLARVIDSYITNNDTGFTEIQTQIAPLLFVAYSTILQVSQVSY
ISRDGLMFSYIAESNTSVAVFANSSSNSSRGDYTWYTQTVDQLTGRLNGNSTKSQSLDVT
HTDWFQAAQSNNYTTAFVGTSLGGEDNETLIQSVVSLYSKKGLVSLGFPVKTLTEVLNSL
NLHGEELYMWTKDGTVLVREGSLNDSFFISNGSICFGRESNSLWSQCIPENCSSSGYEVE
IKRLRYQAFCSVIEVSGVPLRYTLMFPNKGGATRIKHQAEKAKYQLIVVMIFLGFGWPVW
FVWFMMQATRREMHMRATLINQMEATQQAERKSMNKSQAFANASHDIRGALAGMKGLIDI
CRDGVKPGSDVDTTLNQVNVCAKDLVALLNSVLDMSKIESGKMQLVEEDFNLSKLLEDVI
DFYHPVAMKKGVDVVLDPHDGSVFKFSNVRGDSGRLKQILNNLVSNAVKFTVDGHIAVRA
WAQRPGSNSSVVLASYPKGVSKFVKSMFCKNKEESSTYETEISNSIRNNANTMEFVFEVD
DTGKGIPMEMRKSVFENYVQVRETAQGHQGTGLGLGIVQSLVRLMGGEIRITDKAMGEKG
TCFQFNVLLTTLESPPVSDMKVRQEIEAGGDYVSTPNLGLTINTSLGGSMNIRNLSPRFN
NCLSSSPKQEGSRVVLLLKNEERRRVTEKYIKNLGIKVTVVEKWEHLSYALERLFGFSPQ
SSMGRAECSLSCPSSRELPFIGMDGIDSRSQLPKRRSISFSAVVLLVIDAKTGPFFELCD
IVKQFRRGLPHGISCKVVWLNESSTRVSERGDISCSRPLHGSRLMEVLKMLPEFGGTVLK
EPPTELQRESLLRHSFVAERSPKHKVQEEGPSSMFNKKLGKRIMASTDSESETRVKSVRT
GRKPIGNPEDEQETSKPSDDEFLRGKRVLVVDDNFISRKVATGKLKKMGVSEVEQCDSGK
EALRLVTEGLTQREEQGSVDKLPFDYIFMDCQMPEMDGYEATREIRKVEKSYGVRTPIIA
VSGHDPGSEEARETIQAGMDAFLDKSLNQLANVIREIESKRH
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgaaagttacaaagcttgtggcttcacgtccaattgtggtcttttgcgtcctg
gcattcctggtggttgttttcgagtgcatttggatctcaaattggcgaacaacaacggag
aacctagtcaaagaggtcgcttcatttaccgaagatctccggacaagtctagtttcggag
attgaaaacatcggaaaatttacatatgccaagacaaacttatctacgatcggtttagcg
agagttatagattcttatatcaccaacaacgacactggttttacagagattcaaacacag
atcgcaccattgttgtttgtagcttattcaacgatccttcaagtctcacaagtttcgtac
atcagtagggacggtctcatgttttcttacattgcagaatcaaacacaagtgtcgctgtt
tttgccaattcctcgtcgaattcaagtcgtggagactacacttggtacactcaaaccgtg
gatcagttaactggtcgtcttaacgggaactcaacgaaatctcagtcgttagatgtaacc
catacagattggttccaagcagcacagagtaataactacactacagcctttgtaggaacg
agcttgggaggagaagataacgagactctaatacagagcgtggttagcttgtacagcaag
aaaggtcttgtttctttagggtttccggttaagactttaaccgaagttttgaacagtttg
aatctacacggcgaagagctttacatgtggacaaaggacgggacggtgcttgttcgtgaa
ggttcactgaatgattctttcttcatctccaatggctcgatttgcttcggtagagaatcg
aactccctctggtctcaatgcatccctgaaaattgcagttccagtggctacgaggtggag
atcaaaagattaagataccaagctttttgctctgttattgaagtttcgggcgttcctctg
agatacacactcatgtttcccaacaaaggaggagcaacacgcatcaagcaccaagcggaa
aaggcaaaatatcaacttattgtggttatgatatttcttggcttcggttggcctgtatgg
tttgtgtggtttatgatgcaagcaacaaggagagagatgcatatgcgtgcaacgctgata
aaccaaatggaagcgacacaacaagctgagagaaagagcatgaacaagagtcaagcattt
gcaaatgctagccacgatattagaggtgcccttgcagggatgaaaggtctgattgatata
tgtcgtgatggagttaaacctggctccgacgtagacaccactctcaaccaagtgaatgtt
tgcgccaaggatttggttgctctgctcaactctgttttggacatgagcaaaatcgaaagc
gggaagatgcagttagtggaagaagatttcaacttgtcgaaacttcttgaagacgtcatc
gatttttaccatcccgttgcgatgaagaaaggggttgatgtagttttggatccgcacgat
ggctcggttttcaaattctcgaatgtacgaggggatagtggcagactgaagcagattctg
aacaatcttgttagcaatgctgtcaagttcaccgtcgacgggcacattgcggtaagagct
tgggctcagaggccaggttccaatagctctgtggtccttgcatcatatcctaaaggtgtg
tccaagtttgtaaagagtatgttctgcaagaataaagaagagtcatcaacctacgagaca
gaaatatcgaattccataagaaacaatgcaaacacgatggagtttgtgtttgaagtggat
gatactggtaaagggatacctatggagatgcgtaagtcggtatttgaaaactatgttcaa
gtaagagaaacagctcaaggacaccaaggaactggtttagggctcgggattgtgcagtct
ttggtaagattaatgggaggggagataagaatcaccgacaaggccatgggagagaaagga
acatgtttccaattcaatgttttattgacaacattagagtctcctccagtgagtgacatg
aaagtgagacaggagatcgaagcaggaggcgattatgtatccacgccaaacctcgggctg
actataaacacttcacttggaggtagcatgaatatacgtaacctgagtcctagattcaac
aactgtctcagctcaagtccaaagcaagaaggttctagagtggttcttctattgaaaaat
gaagaacgcagaagagttacagagaaatacataaagaatcttgggattaaagttacagtg
gtggagaaatgggagcatttgagttatgctttggagagactttttggattttcacctcag
agttccatgggaagagcagagtgtagtttgtcatgtccgagctcaagggagttacctttc
attggcatggacggtattgattcaagaagccaacttcctaaaaggagaagcatcagtttc
tctgcagttgtccttttggtgattgatgcaaaaactggaccattttttgagctgtgcgat
attgtcaaacagtttcgtagaggcttgccccatggaatatcctgtaaagttgtttggctt
aacgaatcgagcactcgtgtaagtgagagaggggacattagttgttcgagacctttgcac
ggatcgcgtcttatggaagtcttgaagatgttgcctgaatttggaggaactgtgctaaaa
gaaccacctactgagctgcaaagggaatcattgctgagacattcttttgttgcagagaga
tcaccaaaacataaagtccaagaagaggggccaagctcaatgtttaacaaaaaattaggt
aagaggataatggcatcaacagattcagagagtgagactagggtcaagtcagtgcgtacc
ggtcgaaagcctattgggaacccagaggacgagcaagagacttccaagccgagtgacgat
gaattcttaagaggaaagagagttcttgtggtcgatgataactttatatcacgtaaagtt
gcaacaggaaagctgaagaagatgggagtctcagaggtcgaacaatgcgacagtgggaaa
gaagctttgagattagtcactgaagggcttacacaaagagaagaacaaggttcagtagat
aaacttccgtttgactacatattcatggactgccaaatgccagaaatggatggctatgaa
gcaactagagagattaggaaagtggagaaaagttatggggtgcgtacaccaattatagct
gtatctggtcatgatcctggttcagaggaagcaagagaaaccattcaagctggaatggac
gccttcttagataaaagcttgaatcaacttgcaaacgtcattagagaaatcgaaagcaaa
cgtcactag

DBGET integrated database retrieval system