KEGG   Arabidopsis thaliana (thale cress): AT2G47470Help
Entry
AT2G47470         CDS       T00041                                 

Gene name
UNE5
Definition
(RefSeq) thioredoxin family protein
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT2G47470 (UNE5)
Enzymes [BR:ath01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AT2G47470 (UNE5)
Chaperones and folding catalysts [BR:ath03110]
 Protein folding catalysts
  Protein disulfide isomerase
   AT2G47470 (UNE5)
Membrane trafficking [BR:ath04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    AT2G47470 (UNE5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin ERp29 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_8 Thioredoxin_7 Thioredoxin_6 Redoxin HyaE
Motif
Other DBs
NCBI-GeneID: 819360
NCBI-ProteinID: NP_182269
MIPS: AT2G47470.1
TAIR: AT2G47470
Araport: AT2G47470
UniProt: O22263 A0A178W1F8
Position
2
AA seq 361 aa AA seqDB search
MAKSQIWFGFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAP
EYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAE
ALAEYVNKEGGTNVKLAAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPT
YEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDD
FVSFINEKSGTSRDSKGQLTSKAGIVESLDALVKELVAASEDEKKAVLSRIEEEASTLKG
STTRYGKLYLKLAKSYIEKGSDYASKETERLGRVLGKSISPVKADELTLKRNILTTFVAS
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatctcagatctggtttggttttgcgttactcgcgttgcttctggtttcagcc
gtagctgacgatgtggttgttttgactgacgatagcttcgaaaaggaagttggtaaagat
aaaggagctctcgtcgagttttacgctccctggtgtggtcactgcaagaaacttgctcca
gagtatgaaaagctaggggcaagcttcaagaaggctaagtctgtgttgattgcaaaggtt
gattgtgatgagcaaaagagtgtctgtactaaatatggtgttagtggatacccaaccatt
cagtggtttcctaaaggatctcttgaacctcaaaagtatgagggtccacgcaatgctgaa
gctttggctgaatacgtgaacaaggaaggaggcaccaacgtaaaattagctgcagttcca
caaaacgtggttgttttgacacctgacaatttcgatgagattgttctggatcaaaacaaa
gatgtcctagtcgaattttatgcaccatggtgtggccactgcaaatcactcgctcccaca
tacgaaaaggtagccacagtgtttaaacaggaagaaggtgtagtcatcgccaatttggat
gctgatgcacacaaagcccttggcgagaaatatggagtgagtggattcccaacattgaaa
ttcttcccaaaggacaacaaagctggtcacgattatgacggtggcagggatttagatgac
tttgtaagcttcatcaacgagaaatctgggaccagcagggacagtaaagggcagcttact
tcaaaggctggtatagtcgaaagcttagatgctttggtaaaagagttagttgcagctagt
gaagatgagaagaaggcagtgttgtctcgcatagaagaggaagcaagtacccttaagggc
tccaccacgaggtatggaaagctttacttgaaactcgcaaagagctacatagaaaaaggt
tcagactatgctagcaaagaaacggagaggcttggacgggtgcttgggaagtcgataagt
ccagtgaaagctgatgaactcactctcaagagaaatatcctaaccacgttcgttgcttct
tcttaa

DBGET integrated database retrieval system