KEGG   Arabidopsis thaliana (thale cress): AT2G47470Help
Entry
AT2G47470         CDS       T00041                                 

Gene name
UNE5
Definition
protein disulfide-isomerase like 2-1
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ath04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 323 aa AA seqDB search
MAKSQIWFGFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAP
EYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAE
ALAEYVNKEGGTNVKLAAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPT
YEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDD
FVSFINEKSGTSRDSKGQLTSKAGIVESLDALVKELVAASEDEKKAVLSRIEEEASTLKG
STTRYVTLLETRKELHRKRFRLC
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatctcagatctggtttggttttgcgttactcgcgttgcttctggtttcagcc
gtagctgacgatgtggttgttttgactgacgatagcttcgaaaaggaagttggtaaagat
aaaggagctctcgtcgagttttacgctccctggtgtggtcactgcaagaaacttgctcca
gagtatgaaaagctaggggcaagcttcaagaaggctaagtctgtgttgattgcaaaggtt
gattgtgatgagcaaaagagtgtctgtactaaatatggtgttagtggatacccaaccatt
cagtggtttcctaaaggatctcttgaacctcaaaagtatgagggtccacgcaatgctgaa
gctttggctgaatacgtgaacaaggaaggaggcaccaacgtaaaattagctgcagttcca
caaaacgtggttgttttgacacctgacaatttcgatgagattgttctggatcaaaacaaa
gatgtcctagtcgaattttatgcaccatggtgtggccactgcaaatcactcgctcccaca
tacgaaaaggtagccacagtgtttaaacaggaagaaggtgtagtcatcgccaatttggat
gctgatgcacacaaagcccttggcgagaaatatggagtgagtggattcccaacattgaaa
ttcttcccaaaggacaacaaagctggtcacgattatgacggtggcagggatttagatgac
tttgtaagcttcatcaacgagaaatctgggaccagcagggacagtaaagggcagcttact
tcaaaggctggtatagtcgaaagcttagatgctttggtaaaagagttagttgcagctagt
gaagatgagaagaaggcagtgttgtctcgcatagaagaggaagcaagtacccttaagggc
tccaccacgaggtatgttactttacttgaaactcgcaaagagctacatagaaaaaggttc
agactatgctag

DBGET integrated database retrieval system