KEGG   Arabidopsis thaliana (thale cress): AT2G47550Help
Entry
AT2G47550         CDS       T00041                                 

Definition
probable pectinesterase/pectinesterase inhibitor 20
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT2G47550
   00500 Starch and sucrose metabolism
    AT2G47550
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AT2G47550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 560 aa AA seqDB search
MSQKLMFLFTLACLSSLPSPFISAQIPAIGNATSPSNICRFAPDPSYCRSVLPNQPGDIY
SYGRLSLRRSLSRARRFISMIDAELDRKGKVAAKSTVGALEDCKFLASLTMDYLLSSSQT
ADSTKTLSLSRAEDVHTFLSAAITNEQTCLEGLKSTASENGLSGDLFNDTKLYGVSLALF
SKGWVPRRQRSRPIWQPQARFKKFFGFRNGKLPLKMTERARAVYNTVTRRKLLQSDADAV
QVSDIVTVIQNGTGNFTTINAAIAAAPNKTDGSNGYFLIYVTAGLYEEYVEVPKNKRYVM
MIGDGINQTVITGNRSVVDGWTTFNSATFILSGPNFIGVNITIRNTAGPTKGQAVALRSG
GDLSVFYSCSFEAYQDTLYTHSLRQFYRECDVYGTVDFIFGNAAVVLQNCNLYPRQPRKG
QSNEVTAQGRTDPNQNTGTAIHGCTIRPADDLATSNYTVKTYLGRPWKEYSRTVVMQTYI
DGFLEPSGWNAWSGDFALSTLYYAEYNNTGPGSDTTNRVTWPGYHVINATDASNFTVTNF
LVGEGWIGQTGVPFVGGLIA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaaactcatgttcttgttcacccttgcctgcctctcctcgttaccatctcct
tttatctccgcccaaataccggccattggaaatgccacttcaccgtcaaatatatgtaga
ttcgcgccggatccatcttattgtagatcggttcttccaaaccagcccggagatatatat
tcctacggacgtttgtctctacgaagatccctctcacgagcccgccggttcatttcgatg
atcgacgctgaacttgaccggaaaggcaaagtggctgctaaatccacagtaggggctctc
gaagactgcaaattcctagccagcctgactatggactacctccttagtagctcacagacg
gctgattccaccaaaacactgtcgttatctagggccgaggatgttcatacatttctgagt
gctgccatcaccaatgagcagacttgtcttgaaggacttaaatcaacggcgtccgaaaat
ggtctttccggtgatcttttcaacgatacaaaactctatggggtgtctcttgcccttttc
tccaaaggttgggtgccaagaaggcaaagatcgagaccgatttggcaaccacaagccagg
ttcaaaaagttttttggtttccgtaacggtaaattaccgttaaagatgacggaaagggca
cgtgccgtttacaacaccgtgactagaagaaagcttctccaatcggatgcagacgccgtt
caggtgagcgacattgtgacggtgatccagaacgggacgggaaacttcacgaccataaac
gccgccattgcagctgcaccaaataaaactgacggtagtaacggttacttcttgatctac
gtaacggcgggattgtacgaggaatacgtggaagttcccaagaacaagagatatgtgatg
atgatcggtgacggcatcaaccagaccgttatcaccggaaacaggagtgtcgttgatgga
tggacaactttcaattcagccacatttattctatcaggtcccaactttattggtgtaaac
ataacaatccgcaatacggcaggaccaaccaaaggccaagctgtggcattgaggagtggt
ggggacttgtctgttttctacagttgtagttttgaagcctatcaagacacgttatacaca
cattctctcagacagttttatcgtgaatgtgatgtctatggtactgttgattttatattt
ggtaacgctgcagtggtattacaaaactgtaatttgtatccacgtcaacctcgcaaaggt
caatcgaacgaggttacggctcaaggtcgtactgatccgaaccaaaacactgggacggca
attcatggttgtactataagaccggcagatgatttggctacgagcaactatacagtgaag
acttatcttggtcgaccatggaaggaatattctagaaccgttgtcatgcaaacttacata
gacgggtttctagaaccgagtggttggaatgcatggtctggtgattttgcattgagcaca
ctttactacgcggaatataataataccggacctggttctgacacgacaaaccgagtcact
tggcctggttatcacgtcatcaacgcaactgatgcttccaatttcacggtcaccaatttc
cttgttggtgaaggttggattggacaaaccggagtgcctttcgtgggtggactgatcgca
taa

DBGET integrated database retrieval system