KEGG   Arabidopsis thaliana (thale cress): AT2G47550Help
Entry
AT2G47550         CDS       T00041                                 

Definition
(RefSeq) Plant invertase/pectin methylesterase inhibitor superfamily
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00040  Pentose and glucuronate interconversions
ath01100  Metabolic pathways
Module
ath_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT2G47550
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AT2G47550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase PMEI Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 819368
NCBI-ProteinID: NP_566103
MIPS: AT2G47550.1
TAIR: AT2G47550
Araport: AT2G47550
UniProt: O22256 A0A178VWW1
Position
2
AA seq 560 aa AA seqDB search
MSQKLMFLFTLACLSSLPSPFISAQIPAIGNATSPSNICRFAPDPSYCRSVLPNQPGDIY
SYGRLSLRRSLSRARRFISMIDAELDRKGKVAAKSTVGALEDCKFLASLTMDYLLSSSQT
ADSTKTLSLSRAEDVHTFLSAAITNEQTCLEGLKSTASENGLSGDLFNDTKLYGVSLALF
SKGWVPRRQRSRPIWQPQARFKKFFGFRNGKLPLKMTERARAVYNTVTRRKLLQSDADAV
QVSDIVTVIQNGTGNFTTINAAIAAAPNKTDGSNGYFLIYVTAGLYEEYVEVPKNKRYVM
MIGDGINQTVITGNRSVVDGWTTFNSATFILSGPNFIGVNITIRNTAGPTKGQAVALRSG
GDLSVFYSCSFEAYQDTLYTHSLRQFYRECDVYGTVDFIFGNAAVVLQNCNLYPRQPRKG
QSNEVTAQGRTDPNQNTGTAIHGCTIRPADDLATSNYTVKTYLGRPWKEYSRTVVMQTYI
DGFLEPSGWNAWSGDFALSTLYYAEYNNTGPGSDTTNRVTWPGYHVINATDASNFTVTNF
LVGEGWIGQTGVPFVGGLIA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaaactcatgttcttgttcacccttgcctgcctctcctcgttaccatctcct
tttatctccgcccaaataccggccattggaaatgccacttcaccgtcaaatatatgtaga
ttcgcgccggatccatcttattgtagatcggttcttccaaaccagcccggagatatatat
tcctacggacgtttgtctctacgaagatccctctcacgagcccgccggttcatttcgatg
atcgacgctgaacttgaccggaaaggcaaagtggctgctaaatccacagtaggggctctc
gaagactgcaaattcctagccagcctgactatggactacctccttagtagctcacagacg
gctgattccaccaaaacactgtcgttatctagggccgaggatgttcatacatttctgagt
gctgccatcaccaatgagcagacttgtcttgaaggacttaaatcaacggcgtccgaaaat
ggtctttccggtgatcttttcaacgatacaaaactctatggggtgtctcttgcccttttc
tccaaaggttgggtgccaagaaggcaaagatcgagaccgatttggcaaccacaagccagg
ttcaaaaagttttttggtttccgtaacggtaaattaccgttaaagatgacggaaagggca
cgtgccgtttacaacaccgtgactagaagaaagcttctccaatcggatgcagacgccgtt
caggtgagcgacattgtgacggtgatccagaacgggacgggaaacttcacgaccataaac
gccgccattgcagctgcaccaaataaaactgacggtagtaacggttacttcttgatctac
gtaacggcgggattgtacgaggaatacgtggaagttcccaagaacaagagatatgtgatg
atgatcggtgacggcatcaaccagaccgttatcaccggaaacaggagtgtcgttgatgga
tggacaactttcaattcagccacatttattctatcaggtcccaactttattggtgtaaac
ataacaatccgcaatacggcaggaccaaccaaaggccaagctgtggcattgaggagtggt
ggggacttgtctgttttctacagttgtagttttgaagcctatcaagacacgttatacaca
cattctctcagacagttttatcgtgaatgtgatgtctatggtactgttgattttatattt
ggtaacgctgcagtggtattacaaaactgtaatttgtatccacgtcaacctcgcaaaggt
caatcgaacgaggttacggctcaaggtcgtactgatccgaaccaaaacactgggacggca
attcatggttgtactataagaccggcagatgatttggctacgagcaactatacagtgaag
acttatcttggtcgaccatggaaggaatattctagaaccgttgtcatgcaaacttacata
gacgggtttctagaaccgagtggttggaatgcatggtctggtgattttgcattgagcaca
ctttactacgcggaatataataataccggacctggttctgacacgacaaaccgagtcact
tggcctggttatcacgtcatcaacgcaactgatgcttccaatttcacggtcaccaatttc
cttgttggtgaaggttggattggacaaaccggagtgcctttcgtgggtggactgatcgca
taa

DBGET integrated database retrieval system