KEGG   Arabidopsis thaliana (thale cress): AT2G47590Help
Entry
AT2G47590         CDS       T00041                                 

Gene name
PHR2
Definition
(RefSeq) photolyase/blue-light receptor 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 447 aa AA seqDB search
MDSSNVEENLNPETKSAEEQNPLAIFHSSLPIASLSLTLFPSSTQFLKLFAHHPNKVKIP
TQASSLTHLSLSSVSPFPSSRISFKSTIAANPLQSPLSIVPRRPVDPSSAAALRRAAVVW
FRNDLRVHDNECLNSANDECVSVLPVYCFDPRDYGKSSSGFDKTGPFRAQFLIESVSELR
KNLQARGSNLVVRVGKPEAVLVELAKEIGADAVYAHREVSHDEVKAEGKIETAMKEEGVE
VKYFWGSTLYHLDDLPFKIEDLPSNYGAFKDKVQKLEIRKTIAALDQLKSLPSRGDVELG
DIPSLLDLGISPTPRTSQEGKPTMVGGETEALTRLKSFAADCQARLSKGNQKGGNNSVFG
ANFSCKISPWLAMGSISPRSMFDELKKTISASTTSTTPRNGPGDTGLNWLMYELLWRDFF
RFITKKYSSAKTQVEAGPATACTGAFA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggattcttcgaatgttgaagaaaacctaaacccagaaacaaaatccgcagaagaacaa
aacccacttgccattttccattcttctctaccaatcgcatctctttctctgaccttgttc
ccatcctcgactcaatttctcaaattgtttgctcatcatccaaacaaggttaagatccct
acgcaggcttcttctctcactcatctctctctttcttctgtctctccttttccttcttcc
agaatctctttcaaatccaccatcgctgctaaccctcttcaatcccctctctccatcgtc
cctcgtcgtcccgttgatccttcctccgccgccgctctccgccgtgctgctgtcgtctgg
ttccgcaatgacctccgtgtccacgacaacgagtgtctcaactccgccaacgacgagtgc
gtctccgttttgcccgtttactgcttcgaccctagagattacggcaagtcctcttccggc
ttcgacaaaacggggccttttcgtgcccagtttctgattgagtccgtttcggagctccgg
aagaatctccaagccagagggtcgaatctagttgtccgtgtcgggaaacctgaagctgtt
ttggtggaattggctaaggagattggagctgacgcggtttatgctcacagagaagtgtct
cacgacgaggttaaagcggaagggaagatagagaccgcgatgaaggaggaaggcgttgaa
gtcaagtatttctggggaagcactctctatcatttggatgatttgcccttcaaaattgaa
gacttgccgtcaaattacggagctttcaaggataaagtccagaaattggagattaggaag
actatcgcagcgcttgatcaattgaaaagcttgccctctcgaggagacgttgagcttggc
gatattccttctctcctggatcttggcattagccccactcctaggactagccaggagggg
aaaccgacaatggttggaggagagacagaggcgttgactagactaaagagctttgccgcg
gattgtcaggctcggttgagcaagggaaaccagaaaggaggcaacaacagtgtctttggt
gcaaacttctcttgcaagatatcaccttggttagccatgggaagcatctctcctcgttcc
atgttcgatgagctgaagaaaacaatctccgcatcaaccacctccacaactccaaggaac
ggaccgggagatacaggactcaactggttaatgtatgagttgctatggagggatttcttc
aggtttataaccaagaaatacagctcagcgaagacgcaggtcgaggctggtccggctaca
gcctgtaccggtgcctttgcttaa

DBGET integrated database retrieval system