KEGG   Arabidopsis thaliana (thale cress): AT2G47990Help
Entry
AT2G47990         CDS       T00041                                 

Gene name
SWA1
Definition
(RefSeq) transducin family nucleolar protein with WD40 repeats
  KO
K14549  
U3 small nucleolar RNA-associated protein 15
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    AT2G47990 (SWA1)
Ribosome biogenesis [BR:ath03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    AT2G47990 (SWA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 530 aa AA seqDB search
MEEELRVRLNDHQVSKVFPVKPKSTAKPVSESETPESRYWSSFKNHSTPNLVSSVAALAF
SPVHPHSLAVAHSATVSLFSSQSLSSSRRFSFRDVVSSVCFRSDGALFAACDLSGVVQVF
DIKERMALRTLRSHSAPARFVKYPVQDKLHLVSGGDDGVVKYWDVAGATVISDLLGHKDY
VRCGDCSPVNDSMLVTGSYDHTVKVWDARVHTSNWIAEINHGLPVEDVVYLPSGGLIATA
GGNSVKVWDLIGGGKMVCSMESHNKTVTSLRVARMESAESRLVSVALDGYMKVFDYGRAK
VTYSMRFPAPLMSLGLSPDGSTRVIGGSNGMVFAGKKKVRDVVGGQKKSLNLWSLISDVD
ESRRRALRPTYFRYFQRGQSEKPSKDDYLVKEKKGLKLTRHDKLLKKFRHKEALVSVLEE
KKPANVVAVMEELVARRKLMKCVSNMEEGELGMLLGFLQRYCTVQRYSGLLMGLTKKVLE
TRAEDIKGKNEFKGLLRNLKREVNQEIRIQQSLLEIQGVIAPLMRIAGRS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagcttcgtgttcggctgaatgaccatcaagtgtcaaaggttttccctgtg
aagcccaaatcaacggcgaaacctgtttccgaatcggagactccggaatcgaggtactgg
tcctccttcaaaaatcattccacacctaatctcgtctcctccgtagccgctttggctttc
tctccggtccaccctcactccttggccgtcgctcactccgccaccgtctccctcttttcc
tcgcagtcgctttcctcctcccgccgtttctccttccgcgatgttgtctcctccgtctgt
ttccgttccgacggagctcttttcgcggcatgcgatctctccggtgtggtccaggtcttc
gacatcaaggaacgaatggctctccgtactctccgctcccacagcgcccccgctcgattc
gtcaagtatccagttcaggacaagctccacttggtctccggaggcgacgatggagtcgtc
aagtactgggatgtcgccggagcaacagtcatctcagatctgctaggccacaaggattat
gtccgctgcggtgattgctcgcccgtcaacgattcaatgttggtaacaggctcttacgat
cacacggtgaaggtgtgggacgccagagtccacacgtccaattggattgccgagatcaac
cacggactcccagtggaggacgtcgtatacctgccttccggtggattgatcgcaaccgct
ggtggcaacagcgtcaaggtatgggatttgatcggaggcgggaagatggtttgctccatg
gagagtcacaacaagaccgtcacgtctctccgcgttgcgagaatggaatcggctgagagt
cgacttgtgagcgttgctttggacggatacatgaaagtcttcgattacgggagagcaaag
gtgacttactctatgaggtttcctgctcctctcatgtctcttggcctttcccccgatggt
tccactcgggtaatcggagggtctaatggcatggtgtttgccggtaagaagaaggtgaga
gatgttgttggaggacagaagaaaagtttgaatctctggagtctgataagcgatgtggat
gagagtaggagaagggcactgaggcctacgtatttcaggtacttccagagagggcagagc
gagaagccatccaaagatgattacttggtcaaggagaagaaaggattgaagctgacgaga
cacgataagctcttgaagaagttcaggcataaggaagctctggtctcggtgttggaggag
aagaaaccggccaatgttgtggcagtgatggaagaattagtggcgaggaggaagctgatg
aagtgcgtgtcgaatatggaggaaggcgagttgggaatgctgctaggcttcttacaaagg
tactgcactgtgcagaggtattcaggattgttgatgggattgacgaagaaggttttggag
acgagagctgaagacatcaagggtaaaaacgagtttaaagggcttctcaggaacttgaag
agggaggttaatcaggagattaggatacaacagtctcttctagagattcagggtgttatt
gctcctttgatgagaattgcgggtagaagttga

DBGET integrated database retrieval system