KEGG   Arabidopsis thaliana (thale cress): AT2G48020Help
Entry
AT2G48020         CDS       T00041                                 

Definition
(RefSeq) sugar transporter ERD6-like 7
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 463 aa AA seqDB search
MSKASDAVREPLVDKNMAGSKPDQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDL
SLTIAEFSLFGSLLTFGAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIIFAKGVVA
LDLGRLATGYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTLVTWR
VLALIGIIPCAASFLGLFFIPESPRWLAKVGRDTEFEAALRKLRGKKADISEEAAEIQDY
IETLERLPKAKMLDLFQRRYIRSVLIAFGLMVFQQFGGINGICFYTSSIFEQAGFPTRLG
MIIYAVLQVVITALNAPIVDRAGRKPLLLVSATGLVIGCLIAAVSFYLKVHDMAHEAVPV
LAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWFGAWAVSYTFNFLM
SWSSYGTFLIYAAINALAIVFVIAIVPETKGKTLEQIQAIVNP
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggcaagtgatgccgtcagagaaccattggtggacaagaatatggctggatca
aaaccagaccagccgtggatggtttatctcagcacattcgttgcggtctgtggttctttt
gcgttcggttcttgtgcgggatactcttcacctgctcaggctgcaattaggaatgacctt
tcattgactatagctgagttttcactctttggttctttactaacttttggcgcaatgatc
ggtgctataacaagcgggcctatagctgatttagttggaagaaagggggcgatgagagtt
tcctctgcattttgtgtagtcgggtggctagcaatcatctttgccaagggagtagtggct
ctggaccttggaagactggcaacgggatatggaatgggagcattttcctatgtggtgcca
atctttatagcagaaattgcacctaaaactttcagaggggctctaaccacactgaaccag
attctgatctgcactggagtgtcggtttccttcatcataggcacactagtgacgtggaga
gtcttggcattaataggaatcatcccatgcgctgcctccttccttggcctcttttttatc
cctgagtctccaagatggctggcaaaagtggggcgtgatacggagtttgaagctgcactg
aggaagctccgtgggaagaaggctgatatttcggaggaggcagcagagatccaggattat
atcgaaactctggaaaggctaccgaaagccaagatgctggatttgtttcagaggagatac
atacgctctgttcttatagctttcgggttgatggtgtttcagcagtttggaggaatcaac
ggaatatgtttctacacaagctcgatatttgagcaagcaggttttcccacaagacttggg
atgataatatatgctgttcttcaggtggtaatcactgcgcttaatgcaccgatagttgac
agagccggaagaaaaccattgctactggtttctgcaacagggttagtgataggctgtttg
atagcagcggtttctttctatctcaaggttcacgacatggcgcacgaagcagtcccagtc
ctggctgttgttggtataatggtgtacataggatcgttttcagcaggaatgggagcaatg
ccgtgggtggtcatgtctgagatatttcccataaacataaaaggagtagcaggaggcatg
gcgacgctggtgaactggtttggagcgtgggctgtttcttacactttcaacttcctcatg
tcctggagctcttacggaactttcctcatttacgctgccatcaacgcgctggccattgtc
ttcgtcattgccatcgtgcctgagacaaaagggaagacattggagcagatccaagctata
gtcaatccatag

DBGET integrated database retrieval system