KEGG   Arabidopsis thaliana (thale cress): AT2G48150Help
Entry
AT2G48150         CDS       T00041                                 

Gene name
GPX4
Definition
glutathione peroxidase 4
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AT2G48150 (GPX4)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT2G48150 (GPX4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AT2G48150 (GPX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 170 aa AA seqDB search
MGASASVPERSVHQFTVKDSSGKDLNMSIYQGKVLLIVNVASKCGFTETNYTQLTELYRK
YKDQDFEILAFPCNQFLYQEPGTSQEAHEFACERFKAEYPVFQKVRVNGQNAAPIYKFLK
ASKPTFLGSRIKWNFTKFLVGKDGLVIDRYGTMVTPLSIEKDIKKALEDA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcttctgcttcggttcccgagagatccgtccatcaattcactgtaaaggatagc
tccggcaaggacctgaatatgagcatttaccaagggaaagtcctcctcatcgtcaatgtt
gcttccaaatgcggtttcaccgaaacaaactatacacagctcaccgaactttaccggaaa
tacaaggaccaagattttgagatcttggcattcccttgcaaccagtttctataccaggag
cccggcacaagtcaagaggctcatgaatttgcctgcgaacgctttaaggccgaataccct
gttttccaaaaggtacgcgtaaacggtcaaaacgcagcaccaatctataaattccttaag
gcaagtaaacccacctttctgggttccagaattaagtggaacttcaccaagttcttggtc
ggcaaagatggcttagtgattgatcgttatggcacgatggttacaccgctatcaatcgag
aaagacatcaagaaagctcttgaagacgcttga

DBGET integrated database retrieval system