KEGG   Arabidopsis thaliana (thale cress): AT3G01890Help
Entry
AT3G01890         CDS       T00041                                 

Definition
(RefSeq) Swi/Snf complex component SWP73-like protein
  KO
K11650  
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     AT3G01890
Chromosome [BR:ath03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    AT3G01890
   PBAF complex
    AT3G01890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 458 aa AA seqDB search
MSGNNELNALKGPQSSLPWPFGMASASFAPSHMAPPNFQPQFQLSQDQGISAPGRRFPHK
PPIGGPPAVPPSMELTPASRKKKHKLPDKSSLQERVAAVLPESALYTQLLEFESRVDAAL
FRKKVDIQDSLKNPPSIQKTLRIYVFNTFSNQIPGPDPPTWTLRIFGRVLDPDHTGGLVQ
NSNPLYPKFSSFFKTLKISLDQSLYPENHLIEWKRDRSPAPLEGFEIKRIGCQEFAATIL
LEMNYVPEKFKTSPALMQVLGIEVDTRPRIIAAIWHYVKVRKLQNPNDPSFFNCDAALHS
VFGEEKMKFTMLSHKISQHLSPPPPIQLVHKIKLSGNNPAISACYDVLVDIPAPVQTELS
NLLANPEKNKEIEACDEAICGAIRKIHEHRRRRAFFLGFSQSPVEFTNALMESQTKDLKL
VAGEASRNAEKEGRSEFFNQPWVEDAAIRYLNRKPAGG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggaataacgagttgaacgcactaaaagggcctcaaagctctctgccttggcca
tttggaatggcctctgcatcgtttgctccctcccacatggcccctcctaactttcaacct
cagtttcagctctctcaagaccaagggattagtgctcctggaagaaggttcccacataaa
cctcccattggaggacctcctgctgttcctcctagtatggagttgactccagcttccagg
aaaaagaaacataagcttccagacaagtcctccttgcaggagcgcgttgctgccgtcttg
cccgagtctgctctctacacacagcttcttgagtttgagtctcgggttgatgccgctctc
ttcagaaagaaagttgacatccaagactcccttaagaaccctccttccattcagaagacc
cttaggatctacgttttcaacaccttttccaaccagatccctggtcctgaccctcccaca
tggactcttaggattttcggcagggtcctggatcctgaccacactggtggattagttcag
aattcaaacccactttatcccaagttctcgtctttcttcaaaacgttaaagatatccctg
gaccagagcctgtatcctgagaaccatctgatcgaatggaaaagggatcgatcgcctgct
cctctggaagggtttgagataaagaggatagggtgtcaggagtttgcagctactatactg
ttggagatgaattacgtccctgagaagttcaagacttctcctgctttgatgcaagttttg
ggcattgaggttgacactcgcccaagaatcattgcggcaatctggcattacgtgaaagtc
aggaaactgcaaaacccaaacgacccttctttcttcaactgtgatgctgctctccacagt
gtttttggggaagagaagatgaaattcactatgctctctcataagatatctcagcaccta
tcacctccgcctcccattcagcttgtacacaagatcaagctttcggggaacaatccagcc
atctcagcatgttacgatgtgcttgtggacataccagcaccggtccaaacggagctttcc
aatctgctcgctaatccagagaagaacaaagagattgaggcatgtgatgaagccatatgc
ggagccataaggaaaatccacgagcacagaaggagacgggcgtttttcttagggtttagc
cagtcaccggtggaattcaccaatgccttgatggaatctcagaccaaagatctgaagctt
gttgcaggagaagcaagtcgaaacgctgagaaagaaggccgatcagagttcttcaatcag
ccatgggtggaggatgctgcaatacgttacttgaaccggaagccagcaggcgggtaa

DBGET integrated database retrieval system