KEGG   Arabidopsis thaliana (thale cress): AT3G02090Help
Entry
AT3G02090         CDS       T00041                                 

Gene name
MPPBETA
Definition
(RefSeq) probable mitochondrial-processing peptidase subunit beta
  KO
K17732  
mitochondrial-processing peptidase subunit beta [EC:3.4.24.64]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.64  mitochondrial processing peptidase
     AT3G02090 (MPPBETA)
Peptidases [BR:ath01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   AT3G02090 (MPPBETA)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    AT3G02090 (MPPBETA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 531 aa AA seqDB search
MAMKNLLSLARRSQRRLFLTQATRSSSSFSAIDSVPASASPTALSPPPPHLMPYDHAAEI
IKNKIKKLENPDKRFLKYASPHPILASHNHILSAPETRVTTLPNGLRVATESNLSAKTAT
VGVWIDAGSRFESDETNGTAHFLEHMIFKGTDRRTVRALEEEIEDIGGHLNAYTSREQTT
YYAKVLDSNVNQALDVLADILQNSKFEEQRINRERDVILREMQEVEGQTDEVVLDHLHAT
AFQYTPLGRTILGPAQNVKSITREDLQNYIKTHYTASRMVIAAAGAVKHEEVVEQVKKLF
TKLSSDPTTTSQLVANEPASFTGSEVRMIDDDLPLAQFAVAFEGASWTDPDSVALMVMQT
MLGSWNKNVGGGKHVGSDLTQRVAINEIAESIMAFNTNYKDTGLFGVYAVAKADCLDDLS
YAIMYEVTKLAYRVSDADVTRARNQLKSSLLLHMDGTSPIAEDIGRQLLTYGRRIPTAEL
FARIDAVDASTVKRVANKYIYDKDIAISAIGPIQDLPDYNKFRRRTYWNRY
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaagaatctactgtccctagctcgccgatctcagaggcgtttattcctcact
caagccacacgatcttcctcttcgttttcagctatcgattcggtgccggcttccgcatct
ccgacggctctatctccaccgccgccgcatcttatgccatacgaccacgcggctgagatt
ataaaaaataagatcaagaagctcgagaatcctgataagaggttccttaaatacgcatct
ccacatccgatcctcgcttcccacaatcacatcttgtcagctccggagactcgtgtcact
accttgcccaatggtctacgagtcgctactgagtcaaatctctcggctaagaccgccacc
gttggagtctggatcgacgctggatctcggtttgagtccgatgagaccaacggaacggct
cattttttggagcatatgatattcaaaggcacggataggcgtacagtgagagcgttggag
gaagagatcgaagatattggtggtcacctgaacgcgtatacatcgagggaacagaccact
tattatgctaaggttttggattccaatgtgaaccaggctttggatgtcttggctgatatc
ctacagaattctaagttcgaggaacagagaattaaccgcgaacgagatgtcatcctcagg
gaaatgcaagaggtggagggacaaaccgatgaagtggttcttgaccatttacatgccact
gcattccaatacacaccccttggaagaactattttgggacctgctcagaacgtcaaatcg
atcaccagagaggatctacagaactacattaagactcactacactgcttccaggatggtg
attgctgctgcaggagctgttaagcatgaggaagttgttgagcaagtgaagaagctattt
accaagttgtcgtctgatccaacaactacttctcaactggttgccaatgaacctgctagt
tttactggttctgaggtccgaatgattgatgacgacctaccccttgcacaatttgctgtt
gcctttgagggagcatcttggactgatccagattccgttgctcttatggttatgcaaact
atgttgggttcgtggaacaaaaatgttggtggtggaaaacacgtgggttctgacctgacc
cagagggttgccattaatgaaatagcagaaagcataatggcattcaacactaactacaag
gatactggactgttcggcgtttatgcagttgccaaggccgattgcttggatgatttatca
tatgccattatgtatgaggtaaccaagctggcctaccgagtttcagacgctgatgtgaca
cgtgcacgaaatcagctgaaatcatcattgttacttcacatggatggaaccagcccaatt
gctgaagatattggtcgtcagctgctgacctatgggcgtagaatcccaaccgctgaactc
tttgctaggatcgatgctgttgatgccagcacggtaaaacgtgttgccaacaaatatatc
tatgacaaagacattgcaatctcagctattggtccaatccaagatttgccagactacaac
aaattcagacgcagaacctactggaaccggtactaa

DBGET integrated database retrieval system