KEGG   Arabidopsis thaliana (thale cress): AT3G02360Help
Entry
AT3G02360         CDS       T00041                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase family protein
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00030  Pentose phosphate pathway
ath00480  Glutathione metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ath_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AT3G02360
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT3G02360
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     AT3G02360
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     AT3G02360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 821163
NCBI-ProteinID: NP_186885
MIPS: AT3G02360.1
TAIR: AT3G02360
Araport: AT3G02360
UniProt: Q9FWA3 A0A178VK18
Position
3
AA seq 486 aa AA seqDB search
MAVQPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFH
DPESFVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAV
AENGFLYLGMGVSGGEEGARNGPSMMPGGSYEAYKNIEDIVLKVAAQVRDSGPCVTYIGK
GGSGNFVKMVHNGIEYGDMQLIAEAYDVLKSVGKLSNEELHSVFSDWNKGELESFLVEIT
ADIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKD
ERVQAAKVFKAGGFGDILTDQKVDKKQLVDDVRKALYASKICSYAQGMNLIRAKSIEKGW
GLKLGELARIWKGGCIIRAIFLDRIKQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVC
LAINSGISTPGMSASLAYFDSYRRERLPANLVQAQRDYFGAHTYERTDVEGSFHTEWFKI
ARQSKI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcaacctacaagaataggtctagctggacttgctgtgatgggtcagaaccta
gctctcaacattgcagagaaaggcttcccaatctctgtttacaacagaactacttccaaa
gttgatgagaccgtcgaacgagccaaaaaggaaggcaatcttcctctttacggcttccat
gaccccgagtcttttgtcaagtccattcagaagccacgcgttattatcatgcttgttaag
gctggttctcccgttgaccagaccatcaagaccctctctgcttatttggagaaaggtgac
tgtattgtcgatggtggtaatgaatggtatgagaacactgagaggagagaaaaagccgtg
gcggagaacggtttcctctaccttggaatgggagtttctggtggtgaagaaggtgctcgt
aatggcccatctatgatgcctggaggctcttatgaagcctacaagaatatcgaagacatt
gttctcaaggttgctgctcaggttagggatagtggtccctgtgtgacttatatcggtaag
ggcgggtctggaaactttgtcaaaatggtccacaatgggatcgagtacggtgatatgcag
ctgattgcagaagcttatgacgtcctcaagtctgttggtaaattatcgaatgaggagctt
cacagtgtcttctctgactggaacaaaggtgagcttgagagtttcttggtagagatcaca
gcagatattttcgggatcaaggacgataagggagatgggcatttggttgacaaggtcttg
gacaaaaccggcatgaaaggcacaggaaagtggaccgtgcagcaagctgctgagctatct
gttcctgctcccaccattgaatcctctcttgatgcgaggttccttagcgggcttaaagat
gaacgtgtgcaagcagctaaagtcttcaaggcaggtgggtttggagatatcttgaccgat
cagaaagttgacaagaaacagctagtcgatgacgtgaggaaggctctttacgcatccaaa
atctgcagctacgcacaaggcatgaaccttatccgtgccaagagcatagaaaaggggtgg
ggattgaagctaggtgagttagctagaatctggaaaggaggctgcatcatcagagcaatc
ttcctagacaggatcaagcaagcttatgacaggaacgcagagctagctaacctcttggtg
gatccagagtttgcgaaagagataatcgagagacagtccgcgtggagaagagtcgtctgc
ttagctatcaactcgggtatcagcacaccgggtatgtctgcgagtctagcctactttgat
tcttacaggagagagagattgccggcaaatctagtccaagcacagagagactactttggt
gctcatacatatgaaaggactgatgtggaaggatctttccacaccgagtggttcaagatt
gcaagacaatctaagatctga

DBGET integrated database retrieval system