KEGG   Arabidopsis thaliana (thale cress): AT3G02360Help
Entry
AT3G02360         CDS       T00041                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 3
  KO
K00033  
6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT3G02360
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AT3G02360
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT3G02360
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     AT3G02360
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     AT3G02360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 486 aa AA seqDB search
MAVQPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFH
DPESFVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAV
AENGFLYLGMGVSGGEEGARNGPSMMPGGSYEAYKNIEDIVLKVAAQVRDSGPCVTYIGK
GGSGNFVKMVHNGIEYGDMQLIAEAYDVLKSVGKLSNEELHSVFSDWNKGELESFLVEIT
ADIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKD
ERVQAAKVFKAGGFGDILTDQKVDKKQLVDDVRKALYASKICSYAQGMNLIRAKSIEKGW
GLKLGELARIWKGGCIIRAIFLDRIKQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVC
LAINSGISTPGMSASLAYFDSYRRERLPANLVQAQRDYFGAHTYERTDVEGSFHTEWFKI
ARQSKI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcaacctacaagaataggtctagctggacttgctgtgatgggtcagaaccta
gctctcaacattgcagagaaaggcttcccaatctctgtttacaacagaactacttccaaa
gttgatgagaccgtcgaacgagccaaaaaggaaggcaatcttcctctttacggcttccat
gaccccgagtcttttgtcaagtccattcagaagccacgcgttattatcatgcttgttaag
gctggttctcccgttgaccagaccatcaagaccctctctgcttatttggagaaaggtgac
tgtattgtcgatggtggtaatgaatggtatgagaacactgagaggagagaaaaagccgtg
gcggagaacggtttcctctaccttggaatgggagtttctggtggtgaagaaggtgctcgt
aatggcccatctatgatgcctggaggctcttatgaagcctacaagaatatcgaagacatt
gttctcaaggttgctgctcaggttagggatagtggtccctgtgtgacttatatcggtaag
ggcgggtctggaaactttgtcaaaatggtccacaatgggatcgagtacggtgatatgcag
ctgattgcagaagcttatgacgtcctcaagtctgttggtaaattatcgaatgaggagctt
cacagtgtcttctctgactggaacaaaggtgagcttgagagtttcttggtagagatcaca
gcagatattttcgggatcaaggacgataagggagatgggcatttggttgacaaggtcttg
gacaaaaccggcatgaaaggcacaggaaagtggaccgtgcagcaagctgctgagctatct
gttcctgctcccaccattgaatcctctcttgatgcgaggttccttagcgggcttaaagat
gaacgtgtgcaagcagctaaagtcttcaaggcaggtgggtttggagatatcttgaccgat
cagaaagttgacaagaaacagctagtcgatgacgtgaggaaggctctttacgcatccaaa
atctgcagctacgcacaaggcatgaaccttatccgtgccaagagcatagaaaaggggtgg
ggattgaagctaggtgagttagctagaatctggaaaggaggctgcatcatcagagcaatc
ttcctagacaggatcaagcaagcttatgacaggaacgcagagctagctaacctcttggtg
gatccagagtttgcgaaagagataatcgagagacagtccgcgtggagaagagtcgtctgc
ttagctatcaactcgggtatcagcacaccgggtatgtctgcgagtctagcctactttgat
tcttacaggagagagagattgccggcaaatctagtccaagcacagagagactactttggt
gctcatacatatgaaaggactgatgtggaaggatctttccacaccgagtggttcaagatt
gcaagacaatctaagatctga

DBGET integrated database retrieval system