KEGG   Arabidopsis thaliana (thale cress): AT3G02900Help
Entry
AT3G02900         CDS       T00041                                 

Definition
(RefSeq) Low-density receptor-like protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 821188
NCBI-ProteinID: NP_001189795
MIPS: AT3G02900.1
TAIR: AT3G02900
Araport: AT3G02900
UniProt: F4IYH7
Position
3
AA seq 168 aa AA seqDB search
MCSSSSCMLLFSDLLFVLMYNGVLAHRNFNAIRKSSTLTVQTKSNRSHKLSVSAGYRGGS
KGGGSSDFVTGFLLGSAVFGTLAYIFAPQIRRSVLSENEYGFKKPEQPMYYDEGLEERRE
ILNEKIGQLNSAIDKVSSRLKGGRSGSSKNTSSPSVPVETDAEAEATA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgtcttcctcttgtatgttactcttctcagatctcttgttcgttttgatgtac
aatggcgtccttgcacaccgaaacttcaatgcgattcgcaagagctctacattgactgtt
caaacaaaatcaaaccgcagtcacaaactctcggtttctgcaggttaccgtgggggaagt
aagggtggtggaagtagtgattttgttaccggttttcttctaggaagtgctgtgttcgga
actctggcttatatctttgctccacagatccgaagatcagtgctgagcgagaatgaatat
ggtttcaagaaaccggagcagccgatgtactatgacgaaggcctagaggagagaagagag
atattgaatgagaaaatcggccaactcaattccgccattgacaaggtttcgtcgcgtctg
aaaggaggtcgaagcggtagcagcaagaacacttcttcgccgtctgtcccagttgaaacc
gacgcagaagcagaagctactgcatga

DBGET integrated database retrieval system