KEGG   Arabidopsis thaliana (thale cress): AT3G02920Help
Entry
AT3G02920         CDS       T00041                                 

Gene name
RPA32B
Definition
replication protein RPA32B
Orthology
K10739  
replication factor A2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AT3G02920 (RPA32B)
   03420 Nucleotide excision repair
    AT3G02920 (RPA32B)
   03430 Mismatch repair
    AT3G02920 (RPA32B)
   03440 Homologous recombination
    AT3G02920 (RPA32B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 298 aa AA seqDB search
MYGGDFDGNAAFAGGGFMPSQATTQAHESSSSLKVYVSDSRRFSGISAAKSSIRNRDVRT
LLPLTLKQLSSASTTGESNFSIDGVDIKTVVIVGRISRMENRITQVDFVVDDGTGWVDCV
RWCHARQETEEMEAVKLGMYVRLHGHLKIFQGKRSVNVFSVRPVTDFNEIVHHFTECMYV
HMYNTKLRGGSITQDTATPRPQMPYSTMPTPAKPYQTGPSNQFPNQFNDSMHGVKQTVLN
YLNQPMHIVSEAGVHCDIIARELRIPLLQVKEALEQLSNDGCIYSTLDETCFKSTANA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaggcgattttgacggcaacgctgctttcgccggcggcggcttcatgccttct
caggcgactacgcaagcccatgaatcctcatcttccctcaaggtttatgtatctgattct
cgtcgtttctcgggaatatctgctgcaaaaagttccattcgaaaccgcgatgtacgtacc
ttgcttcccctgacactgaagcagttgagcagcgcatcaaccactggcgaatcaaatttc
tctattgatggcgttgatattaaaactgttgtaatcgttggacggatttctagaatggag
aacagaatcactcaggtcgattttgttgttgatgacggtacaggctgggttgattgtgtc
agatggtgtcacgctcggcaagaaactgaagaaatggaagcagtcaagctgggaatgtat
gttcgcttacatggacacctgaaaatttttcaagggaaacgatctgtgaatgttttttca
gtcaggcctgtcactgacttcaatgagattgtacaccactttaccgagtgtatgtatgtc
cacatgtacaacaccaagttacggggtggttctattactcaagatactgctactcctagg
ccccaaatgccatattcaacaatgccaacccctgcaaagccctaccaaaccggtccatct
aatcagttcccgaaccaattcaatgattcaatgcatggtgtaaagcagacggtcttgaat
tacctgaatcaacctatgcacattgtatctgaagctggagttcactgtgatataattgcc
cgtgaactcaggattccgctgcttcaagtcaaggaagcgttagaacagctctcaaacgat
ggttgcatatactcgactttggacgagacatgcttcaaatcgactgctaacgcttga

DBGET integrated database retrieval system