KEGG   Arabidopsis thaliana (thale cress): AT3G02920Help
Entry
AT3G02920         CDS       T00041                                 

Gene name
RPA32B
Definition
(RefSeq) Replication protein A, subunit RPA32
  KO
K10739  replication factor A2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Module
ath_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AT3G02920 (RPA32B)
   03420 Nucleotide excision repair
    AT3G02920 (RPA32B)
   03430 Mismatch repair
    AT3G02920 (RPA32B)
   03440 Homologous recombination
    AT3G02920 (RPA32B)
DNA replication proteins [BR:ath03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT3G02920 (RPA32B)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT3G02920 (RPA32B)
   MMR (mismatch exicision repair)
     AT3G02920 (RPA32B)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT3G02920 (RPA32B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon DNA_pol_alpha_N
Motif
Other DBs
NCBI-GeneID: 821187
NCBI-ProteinID: NP_566188
MIPS: AT3G02920.1
TAIR: AT3G02920
Araport: AT3G02920
UniProt: Q8LFJ8
Position
3
AA seq 278 aa AA seqDB search
MYGGDFDGNAAFAGGGFMPSQATTQAHESSSSLKNRDVRTLLPLTLKQLSSASTTGESNF
SIDGVDIKTVVIVGRISRMENRITQVDFVVDDGTGWVDCVRWCHARQETEEMEAVKLGMY
VRLHGHLKIFQGKRSVNVFSVRPVTDFNEIVHHFTECMYVHMYNTKLRGGSITQDTATPR
PQMPYSTMPTPAKPYQTGPSNQFPNQFNDSMHGVKQTVLNYLNQPMHIVSEAGVHCDIIA
RELRIPLLQVKEALEQLSNDGCIYSTLDETCFKSTANA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaggcgattttgacggcaacgctgctttcgccggcggcggcttcatgccttct
caggcgactacgcaagcccatgaatcctcatcttccctcaagaaccgcgatgtacgtacc
ttgcttcccctgacactgaagcagttgagcagcgcatcaaccactggcgaatcaaatttc
tctattgatggcgttgatattaaaactgttgtaatcgttggacggatttctagaatggag
aacagaatcactcaggtcgattttgttgttgatgacggtacaggctgggttgattgtgtc
agatggtgtcacgctcggcaagaaactgaagaaatggaagcagtcaagctgggaatgtat
gttcgcttacatggacacctgaaaatttttcaagggaaacgatctgtgaatgttttttca
gtcaggcctgtcactgacttcaatgagattgtacaccactttaccgagtgtatgtatgtc
cacatgtacaacaccaagttacggggtggttctattactcaagatactgctactcctagg
ccccaaatgccatattcaacaatgccaacccctgcaaagccctaccaaaccggtccatct
aatcagttcccgaaccaattcaatgattcaatgcatggtgtaaagcagacggtcttgaat
tacctgaatcaacctatgcacattgtatctgaagctggagttcactgtgatataattgcc
cgtgaactcaggattccgctgcttcaagtcaaggaagcgttagaacagctctcaaacgat
ggttgcatatactcgactttggacgagacatgcttcaaatcgactgctaacgcttga

DBGET integrated database retrieval system